KEGG   Bos indicus (zebu cattle): 109561071
Entry
109561071         CDS       T04792                                 

Gene name
ICOSLG
Definition
(RefSeq) ICOS ligand
  KO
K06710  inducible T-cell co-stimulator ligand
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109561071 (ICOSLG)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    109561071 (ICOSLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109561071 (ICOSLG)
CD molecules [BR:biu04090]
 Proteins
  109561071 (ICOSLG)
SSDB
Motif
Pfam: V-set Ig_3 ig C2-set_2 I-set
Other DBs
NCBI-GeneID: 109561071
NCBI-ProteinID: XP_019819059
Position
1
AA seq 288 aa
MRPRSPGLFLLLLWGLQAESQEEVRAMVGSDVQLRCIYPEKNSFDLNDLYVYWQISMAGK
GNVDSVVTYHLSGNSSASHGDNHYKDRARLSLDSMKQGDFSLHLRNVTPQDEQKFNCLVF
RKSLELKKILEVAVTLHVAANYSMPVVSGPSQDEELTFTCTSTNGYPRPNVYWINKTDNS
VLDSALQNNTVSLNARGLYDVVSVLRIGRTPHVNVGCCIENVLLHQNLTSGQTETFTGTK
DSITEDPVDGSXSGKHQQVFSVLAVLAVIVLLALATGWLCRSRCPPKS
NT seq 867 nt   +upstreamnt  +downstreamnt
atgcggccgaggagtcctggattgttcctgctgctgctctggggcctgcaagccgagagt
caagaagaagtccgagcgatggtgggcagcgatgtccagctccgctgcatttaccctgaa
aaaaacagcttcgatttaaacgacctttacgtttactggcaaatcagcatggcgggcaaa
gggaatgtcgactccgtggtgacctaccacctgtccggaaacagctctgccagccacggt
gacaaccactacaaggaccgggctcggctgtccttggacagcatgaagcagggygacttc
tctctgcacctgcgcaacgtcaccccccaggatgagcagaagttcaactgcctggtgttt
cggaagtccttggaattaaaaaagattttggaagttgcagtcacgctgcacgtggcagca
aactacagcatgcccgtggtcagtggcccgtcccaggacgaggagctcaccttcacgtgc
acgtctaccaacggctacccgcggccaaatgtgtactggatcaacaagacggacaacagc
gtgctggacagcgccctgcagaataacacggtgtccctgaacgcgcggggcctgtatgat
gtggtcagtgtcctgagaatcgggcgaaccccccatgtcaacgtgggctgctgcattgag
aatgtgctgctacaccagaacctgacgagcggccagacagaaacgttcacgggaaccaag
gacagcatcacagaggacccagtcgatggcagccmcagcgggaaacaccagcaggttttt
agcgtccttgccgtgctggccgtgatcgtgctcctggctctcgccacgggctggctgtgc
aggagcaggtgtccacccaaaagctaa

DBGET integrated database retrieval system