KEGG   Bos indicus (zebu cattle): 109561166
Entry
109561166         CDS       T04792                                 

Gene name
F2RL3
Definition
(RefSeq) proteinase-activated receptor 4
  KO
K04236  coagulation factor II (thrombin) receptor-like 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04015  Rap1 signaling pathway
biu04080  Neuroactive ligand-receptor interaction
biu04610  Complement and coagulation cascades
biu04611  Platelet activation
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109561166 (F2RL3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109561166 (F2RL3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109561166 (F2RL3)
   04611 Platelet activation
    109561166 (F2RL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561166 (F2RL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109561166 (F2RL3)
G protein-coupled receptors [BR:biu04030]
 Rhodopsin family
  Peptide
   Thrombin
    109561166 (F2RL3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 109561166
NCBI-ProteinID: XP_019819122
Position
7
AA seq 379 aa
MWVLLLLWPLALGFSLGDTLTPIGFEDTGSXAEGDDITQRPHPRSFPGQPCANDSNTLEL
PPNSRALLLGWVPTRLVPALYGLALAVGLPANGLALWVLATQVPRLPSTMLLMNLAAADL
LLALALPPRIAYHLRGQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXASGLCVTAWLAAAALAMPLALQQQTFRLSRSDHVLCHDVLPTGAQASYWRP
AFICLAGFGCFLPLLAMVLSYGATLRTLAAGGRRYGHALRLTALVLVSAVALFAPSNVLL
LLHFSNPGPDAWGDLYAAYVPSLALSTLNSCVDPFIYYFVSAEFRSKVQEGLLRRGPGTA
TASREGGSRATGTRSSSLM
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtgggtactcttgctgctgtggcctctggccctggggttcagcctgggtgacaccctg
acccccatcggctttgaggacacggggagcrcagcagaaggcgatgacatcacacagagg
ccccacccccgcagcttccccggccagccctgtgccaatgacagcaacaccctggagctc
cctcccaactctcgggccctgctgctgggctgggtgcccacgaggctggtgcctgcgctc
tatgggctggccctggcagtggggctgcccgccaacggcctggcgctgtgggtgctggcc
acgcaggtgccccgactgccctccaccatgctgctgatgaacctggcggccgctgacctg
ctgctggcgctggcgctgccgccacggattgcctaccacctgcggggccagcgcnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnntggccagcgggctctgcgtcacagcctggctggcg
gcggctgccctggcgatgcccctggcgctgcagcagcagaccttccggctgtcacgctct
gaccacgtgctatgtcacgacgtgctgcccaccggtgcccaggcctcctactggcggccc
gccttcatctgcctggcggggttcggctgcttcctgccgctgctggccatggtgctgagc
tacggggccactctacgcacgctggcggctgggggccggcggtacggccacgcgctgcgg
ctgaccgcgctggtgctggtctccgccgtggccctcttcgcgcccagcaacgtgctgctg
ctgttgcacttctcaaaccctggccctgacgcctggggggacctgtacgccgcctacgtg
cccagcctggcgctcagcaccctcaacagctgtgtggaccccttcatctattacttcgtg
tctgccgagttcaggagcaaggtgcaggaggggttgctccgccggggacctggcacggcc
acggcctccagggagggcggcagccgggcgacggggacccggtcctcctcactcatgtga

KEGG   Bos indicus (zebu cattle): 109564648
Entry
109564648         CDS       T04792                                 

Gene name
F2RL2
Definition
(RefSeq) proteinase-activated receptor 3
  KO
K04235  coagulation factor II (thrombin) receptor-like 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04080  Neuroactive ligand-receptor interaction
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109564648 (F2RL2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109564648 (F2RL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109564648 (F2RL2)
G protein-coupled receptors [BR:biu04030]
 Rhodopsin family
  Peptide
   Thrombin
    109564648 (F2RL2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 109564648
NCBI-ProteinID: XP_019823631
Position
10
AA seq 377 aa
MRAVIFAAVGALLLSPASCQSGMEYDADNSAKPTLSIKTFRGAPQNSFEEFPLSAIEGWT
GTTKTVKIKCPEELDSNLHVNNATMGYLSSPLSTKLIPTIYILVFTVGMPANAVTLWMLF
RTRTIRMTIFYTNLAIADFLFCVTLPFRIAYHLNGNNWVFGEVMCRATTVIFYGNMYCSI
LLLACISINRYLAIVHPFTYRGLPKRTYALLTCGLVWTTVFLYMLPFFILKQEYYLVQQD
ITTCHDVHNTCESSSPFQLYYFISLAFFGFLIPFLVIIYCYTAIIWTLNAKDRRWLWYIK
ASLLTFMIFTICFAPSNIILIIHHANYYYSNTDALYFVYLIALCLGSLNSCLDPFLYFLM
SKITDHSTAYLTMVKLS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgagagccgtcatctttgcagccgttggagcactgcttctgtcgcctgcttcctgtcaa
agcggcatggaatatgatgcagacaactcggcaaagccaaccttgtctattaagaccttc
cgtggagctccccaaaattcttttgaagagttccccctttctgccatagaaggctggaca
ggaaccaccaaaactgtaaaaatcaaatgccctgaagaacttgattcaaatctccatgtg
aataatgctaccatggggtacctgagcagccctttaagtaccaaattgatacccaccatc
tacatcctggtgtttacagtaggtatgccggccaatgcrgtgaccctgtggatgctcttc
aggaccagaaccatccgtatgaccatcttctacaccaacctggccattgcagactttctg
ttttgtgttacactgccctttagaatagcttaccatctcaatgggaacaactgggtattt
ggcgaggtcatgtgccgggccaccacggtcatcttctatggcaacatgtattgctccatt
ctgctcctcgcctgcatcagtatcaatcgctacttagccattgttcatcctttcacttac
cggggactgcccaagcgcacctacgccttgctcacatgtggactggtgtggacaacagtt
ttcttatacatgctgccrtttttcattctgaagcaggagtactatcttgtccagcaagac
attaccacctgccacgatgtccacaacacatgcgagtcctcgtcgcccttccagctctac
tacttcatctccttggcattctttggattcttaatcccatttctggtcattatctactgc
tacacagccatcatttggacgcttaatgcaaaagatcgtagatggttgtggtacattaag
gcgagtctcctcactttcatgatttttaccatttgctttgctccaagcaatattatcctt
ataattcaccatgcaaactactattacagcaacactgatgccttatactttgtctatctc
atagctttgtgcctcggtagcttgaatagttgcctagatccattcctttattttctcatg
tcaaaaatcacagatcactctactgcttaccttacaatggtgaaattatcttag

DBGET integrated database retrieval system