KEGG   Bos indicus (zebu cattle): 109561216
Entry
109561216         CDS       T04792                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04660  T cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04672  Intestinal immune network for IgA production
biu05200  Pathways in cancer
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561216 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561216 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109561216 (IL5)
   04660 T cell receptor signaling pathway
    109561216 (IL5)
   04658 Th1 and Th2 cell differentiation
    109561216 (IL5)
   04657 IL-17 signaling pathway
    109561216 (IL5)
   04664 Fc epsilon RI signaling pathway
    109561216 (IL5)
   04672 Intestinal immune network for IgA production
    109561216 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561216 (IL5)
  09163 Immune disease
   05310 Asthma
    109561216 (IL5)
   05320 Autoimmune thyroid disease
    109561216 (IL5)
   05321 Inflammatory bowel disease
    109561216 (IL5)
   05330 Allograft rejection
    109561216 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109561216 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109561216 (IL5)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109561216 (IL5)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Cytokines
   109561216 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 109561216
NCBI-ProteinID: XP_019819165
UniProt: B5LVN5
Position
7
AA seq 134 aa
MRMHLHLTLVALGAAYVCANAVESTMNRLVAETLTLLSSHRTLLIGDGNLMIPTPQHTNH
QLCIEEVFQGIDTLKNQTAQGDAVKKIFQNLSLIKEYIDLQKRKCGGERWRVKQFLDYLQ
VFLGVINTEWTMES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagaatgcatctgcatttgactttagtagctcttggagctgcttatgtttgtgccaat
gctgtagaaagtaccatgaatagactggtggcagagaccttgacactgctctcctctcat
cgaactctgctgataggtgatgggaacttgatgattcctactcctcagcatacaaatcac
caactgtgcattgaagaagtctttcagggaatagacacattgaagaatcaaactgcacaa
ggggatgctgtgaaaaaaatattccaaaacttgtctttaataaaagaatacatagacctc
caaaaaaggaagtgtggaggagaaagatggagagtgaaacaattcctagactacctgcaa
gtttttcttggtgtgattaacacagagtggacaatggaaagttga

DBGET integrated database retrieval system