KEGG   Bos indicus (zebu cattle): 109561258
Entry
109561258         CDS       T04792                                 

Gene name
MADCAM1
Definition
(RefSeq) mucosal addressin cell adhesion molecule 1
  KO
K06779  mucosal vascular addressin cell adhesion molecule 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109561258 (MADCAM1)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    109561258 (MADCAM1)
SSDB
Motif
Pfam: Adhes-Ig_like
Other DBs
NCBI-GeneID: 109561258
NCBI-ProteinID: XP_019819200
Position
7
AA seq 424 aa
MERGRALLLPLLLGLLQPGRGGLLEVDPPESQVAMAVGESRNFTCRMTCADGRAASVVWR
GLDTSLGAVQSSAGLSILYVLNASLSAAGTRVCVGSCGDVNLQHRVRLLLFAFPDQLTVS
PEAVVPGRDQEVACTAHNVTPPGPDTLSMSLLLGDRELEGVEALPNVTEEPQEGEDSLFQ
VTQRWLLPTSETSSLRTLHCQVTMRLPGRELTRHRTIPVLQGLTSPEPPSITSSELPTMT
PAKPSITASPEPTDTTTPESFVMKPPKPPITTSPELASTYSPASPGPASPGATSSNSSTR
PCLPEIHQSSASGALELLCEVPCGPSMAVRWTQAPGGLEAYETWEAGAQAWLSSRSTLWS
GCHPEGWFQCRLDPGGHMANLYVVPEICSPTMSAALWTSSLALGLLLLVFLAYHLWKRCQ
PTSR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggaacggggccgcgccctcctgcttccmctccttctggggctgctccagcctggccgc
ggtgggctgctggaagtggatccacctgagagccaggtggcgatggccgtgggcgagtcg
cgaaacttcacctgccgcatgacctgcgcagacggcagggcggcctcggtggtgtggcgg
ggcctggacaccagtctgggcgccgtacagtccagcgcgggcctcagcatcctgtacgtg
ctcaacgcctcgctgtctgcggcggggacccgcgtgtgcgtgggctcctgtggggacgtg
aacctccagcaccgggtgcggctcctgctgtttgccttccctgaccagctgactgtatcc
cctgaggccgttgtgccagggagggaccaggaggtggcctgcacggcccacaacgtcaca
cctcctggccctgacaccctctccatgtccctgctcctgggggatcgggaactggaggga
gtggaagccctcccgaacgtgactgaggagccccaggaaggcgaggactcgctgttccaa
gtgacccagcgctggctgctgcccacctcagagacctccagcctgcgcaccctccactgc
caggtgaccatgaggctgcccggccgggagctgacccgccaccggaccattccagtcctg
cagggcctgacctccccggagccccccagcatcacctcctcagagctgcccaccatgacc
cctgcaaagcccagcatcacagcgtccccggagcccactgatacaaccaccccagagtcc
tttgtcatgaagcccccgaagcctcccatcactacctcccccgagctggcctccacctac
agccccgcgagtcctggccccgcaagtcctggcgccacgtccagcaacagctccaccagg
ccgtgcctcccggagatccaccagtcgtcagcatcaggggctttagagctgctgtgcgag
gtgccctgtggtcccagcatggccgtgcgctggacccaggcccctggcgggctggaggcc
tacgagacgtgggaggcgggggcccaagcttggctgagcagcaggagcacgctgtggtcc
gggtgccatcctgagggctggttccagtgtcgcctggaccctgggggccacatggccaac
ctgtatgtggtcccggaaatctgctccccgacgatgtcagctgccctgtggaccagcagc
ttggcgctggggctccttctcctggtgttcctcgcctaccacctgtggaaacgctgccag
cccacaagccgatga

DBGET integrated database retrieval system