KEGG   Bos indicus (zebu cattle): 109561305
Entry
109561305         CDS       T04792                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04620  Toll-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04940  Type I diabetes mellitus
biu05133  Pertussis
biu05134  Legionellosis
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05162  Measles
biu05164  Influenza A
biu05168  Herpes simplex virus 1 infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05321  Inflammatory bowel disease
biu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561305 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561305 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109561305 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    109561305 (IL12B)
   04625 C-type lectin receptor signaling pathway
    109561305 (IL12B)
   04658 Th1 and Th2 cell differentiation
    109561305 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561305 (IL12B)
   05205 Proteoglycans in cancer
    109561305 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109561305 (IL12B)
   05330 Allograft rejection
    109561305 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109561305 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109561305 (IL12B)
   05134 Legionellosis
    109561305 (IL12B)
   05152 Tuberculosis
    109561305 (IL12B)
  09172 Infectious disease: viral
   05162 Measles
    109561305 (IL12B)
   05164 Influenza A
    109561305 (IL12B)
   05168 Herpes simplex virus 1 infection
    109561305 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109561305 (IL12B)
   05145 Toxoplasmosis
    109561305 (IL12B)
   05140 Leishmaniasis
    109561305 (IL12B)
   05142 Chagas disease
    109561305 (IL12B)
   05143 African trypanosomiasis
    109561305 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109561305 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109561305 (IL12B)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109561305 (IL12B)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Cytokines
   109561305 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_4 Ig_3 fn3 Ig_2 I-set
Other DBs
NCBI-GeneID: 109561305
NCBI-ProteinID: XP_019819240
Position
7
AA seq 327 aa
MHPQQLVVSWFSLVLLASPIVAMWELEKNVYVVELDWYPDAPGETVVLTCDTPEEDGITW
TSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSRSLLLLHKKEDGIWSTDILKDQ
KEPKAKSFLKCEAKDYSGHFTCWWLTAISTDLKFSVKSSRGSSDPRGVTCGAAXLSAEKV
SLEHREYNKYTVECQEGSACPAAEESLLIEVVVEAVHKLKYENYTSSFFIRDIIKPDPPK
NLQLRPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFMDQTSAKVTCH
KDANVRVQARDRYYSSFWSEWASVSCS
NT seq 984 nt   +upstreamnt  +downstreamnt
atgcaccctcagcagttggtcgtttcctggttttccctggttttgctggcatctcccatc
gtggccatgtgggaactggagaaaaatgtttatgttgtagaattggattggtatcctgat
gctcctggagaaacagtggtcctcacatgtgacactcctgaagaagatggcatcacctgg
acctcagaccagagcagtgaggtcttgggctctggcaaaaccttgaccatccaagtcaaa
gagtttggagatgctgggcagtacacctgtcacaaaggaggcgaggctctgagtcgttca
ctcctcctgctgcacaaaaaggaagatggaatttggtccactgatattttaaaggatcag
aaagaacccaaagctaagagttttttaaaatgtgaggcaaaggattattctggacacttc
acctgctggtggctgacagcaatcagtactgatttgaaattcagtgtcaaaagcagcaga
ggctcctctgacccccgaggggtgacgtgcggagcagcgtygctctcagcagagaaggtc
agcttggagcacagggagtataacaagtacacagtggagtgtcaggagggcagcgcctgc
ccagccgcygaggagagcctgcttattgaggtcgtggtagaagctgtgcacaagctcaag
tatgaaaactacaccagcagcttcttcatcagggacatcatcaaaccagacccacccaag
aacctgcaactgagaccattaaagaattctcggcaggtggaggtcagctgggagtaccct
gacacgtggagcaccccgcattcctacttctccctgacgttttgtgttcaggtccaggga
aagaacaagagagaaaagaaactcttcatggaccaaacctcagccaaagtcacatgccac
aaggatgccaacgtccgcgtgcaagcccgggaccgctactacagctcattctggagtgaa
tgggcatctgtgtcctgcagttag

DBGET integrated database retrieval system