KEGG   Bos indicus (zebu cattle): 109561581
Entry
109561581         CDS       T04792                                 

Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04064  NF-kappa B signaling pathway
biu04514  Cell adhesion molecules
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu04670  Leukocyte transendothelial migration
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05143  African trypanosomiasis
biu05144  Malaria
biu05150  Staphylococcus aureus infection
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05323  Rheumatoid arthritis
biu05416  Viral myocarditis
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109561581
   04668 TNF signaling pathway
    109561581
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109561581
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109561581
   04670 Leukocyte transendothelial migration
    109561581
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    109561581
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109561581
   05416 Viral myocarditis
    109561581
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109561581
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109561581
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109561581
   05164 Influenza A
    109561581
   05167 Kaposi sarcoma-associated herpesvirus infection
    109561581
   05169 Epstein-Barr virus infection
    109561581
  09174 Infectious disease: parasitic
   05144 Malaria
    109561581
   05143 African trypanosomiasis
    109561581
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109561581
   04090 CD molecules [BR:biu04090]
    109561581
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109561581
   04091 Lectins [BR:biu04091]
    109561581
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109561581
CD molecules [BR:biu04090]
 Proteins
  109561581
Glycosaminoglycan binding proteins [BR:biu00536]
 Hyaluronan
  Cell surface receptors
   109561581
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109561581
SSDB
Motif
Pfam: ICAM_N Ig_2 Ig_3 C2-set_2 Ig_4
Other DBs
NCBI-GeneID: 109561581
NCBI-ProteinID: XP_019819692
Position
7
AA seq 591 aa
MPGPLFRRGKQEVSGKHRPLGPPRPAQRYKRTREALGATVLAARLRPSWSAPPPPAMALG
AAPAAQLALLALLGTLLPGPGGAGISIHPSKAIIPRGDSLTVNCSNSCDQKSTFGLETVL
IKEEVGRGDNWKVFQLRDVQEDIELFCYSNCHKEQTIASMNLTVYWFPEHVELAPLPLWQ
PVGEELNLSCLVSGGAPRAHLSVVLLRGEEELGRQPVGKGEPAKVMFTVQSRREDHGTNF
SCRWELDLRSQGLELFQNTSAPRKLQTYVLPSIDPHLEVPPIVEVGSRWPVNCTLDGLFP
ASDAKVYLVLGDQKLESNITYDGDSVLAKAWMEENEEGTHSLKCSVTLGEVSRRTQENVT
VYSFPLPTLTLSPPEVSEWTTVTVECVTRDGAVVKLNGTSAVPPGPRAQLKLNASASDHR
SNFSCSAALEIAGQVVHKHQTLELHVLYGPRLDQRDCPGNWTWQEGSEQTLKCEAQGNPI
PKLNCSRKGDGASLPIGDLRPVRREVAGTYLCRATSARGRVTREVVLNVLHGQNILDIVI
PVVAVTLILGALGTAGYVYNYQRKIQKYELQKARKAQEEAALKLNAQSTPP
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgccagggcccttgttccggaggggaaagcaggaggtttccgggaagcaccgccccctt
ggcccccctcggccagcccagcggtataaaaggacccgcgaagccctgggcgccacagtc
ttagccgcgcgcctccgccccagctggtccgccccgcctccgcctgcgatggctctcggc
gccgcccctgcagcacagcttgcgctcctggccctgctcgggactctgctcccagggcct
ggaggtgccggaatatcaatacatccttcaaaagccatcataccccgtggagactccctg
acggtgaactgcagtaactcctgtgaccaaaagtcaacatttggcctagagactgtatta
atcaaggaggaagtgggccgtggggacaactggaaggtttttcaactgcgtgatgtgcag
gaagacatcgagctgttttgctactcaaactgtcacaaggaacagacaatagcttcaatg
aacctcaccgtatactggttcccggagcatgtggagctggctcccctgcccctctggcag
cctgtgggtgaagaactcaacctgagctgcctggtgtctggcggggccccccgggcccac
ctctccgtggtgctgctccgaggggaggaggagctgggccggcagcccgtgggaaagggg
gagcccgccaaggtcatgttcacagtgcagtcgagaagagaggaccatggcaccaatttc
tcttgccgctgggaactggacctgcggtcacaagggctggaactcttccagaacacctcg
gcccccaggaagctccagacctatgtcctgccatcgatcgaccctcaccttgaggtcccc
ccgattgtggaagtaggctcacggtggccggtgaattgcacgctggatggactgttccca
gcctcagacgctaaggtctacctggtgctgggggaccagaaactggaatccaatatcacg
tacgatggtgactctgtcttggccaaggcctggatggaggaaaatgaggagggcacccat
tccttgaagtgttcagtgactctgggagaggtcagccggaggacgcaagagaacgtgact
gtctatagcttcccacttcccaccctgaccctgagtcctcctgaggtctcagaatggact
actgtgactgtggaatgtgtgacccgtgatggagctgtggtgaagctgaatggaacctca
gctgtgccgccgggtccgagggcccaattgaagctgaacgccagtgccagcgaccacagg
agcaacttctcctgctctgctgccctggagatagctgggcaggtggtccacaaacaccag
accctggagctccatgtcctgtacggcccccgactagaccagcgggattgcccgggaaac
tggacgtggcaggaaggctcggaacagaccctgaagtgcgaggctcaggggaacccaatc
cccaagctgaactgtagccggaaaggggacggggcttcgctgcccatcggggacctgagg
cccgttaggcgggaggtggcgggcacctacctgtgtcgggccaccagcgctcgtggcaga
gtcacccgtgaagtggtcctgaacgtgctccacggccagaatatcctggacattgtcatt
ccggtagtagctgtgaccctcatcttgggtgctctgggcaccgccggttatgtctataac
taccagcggaagatccagaaatacgagctgcagaaggcccggaaggcccaagaagaggct
gccttgaaactgaatgcacaatccacgccgccctga

KEGG   Bos indicus (zebu cattle): 109561585
Entry
109561585         CDS       T04792                                 

Gene name
ICAM3
Definition
(RefSeq) intercellular adhesion molecule 3
  KO
K06486  intercellular adhesion molecule 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109561585 (ICAM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109561585 (ICAM3)
   04091 Lectins [BR:biu04091]
    109561585 (ICAM3)
CD molecules [BR:biu04090]
 Proteins
  109561585 (ICAM3)
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109561585 (ICAM3)
SSDB
Motif
Pfam: ICAM_N Ig_2 C2-set_2 Ig_3
Other DBs
NCBI-GeneID: 109561585
NCBI-ProteinID: XP_019819699
Position
7
AA seq 544 aa
MMPSGPPPRVYWTSLIFLLLACCLLPTGAQGQTYQVRVEPKDPVVPFGEPLVVNCTLDCP
GPGLISLETALSKEPHSRGLGWAAFRLTNVTGDMEILCSGICNKSQVVGFSNITVFGFPK
RVELAPLPLWQPVGEELNLSCLVSGGAPRAHLSVVLLRGEEELGRQPLGKEEPAKVTFMV
QPRREDHGTNFSCRSELDLRSQGLELFQNTSAPRKLQTYAMPKTAPRLVFPRFWEMETSW
PVNCSLDGLFPASEAHIQLALGNQMLNATVVSHADTLTATATAKTEQEGTQEIVCNVTLG
VENRETRESLVAYRFQGPNLNLSESNATEGTPVTVTCAAGPQVQVMLDGVPAAVPGQPAQ
LQLKATEMDDRRTFFCNATLKVHGVTLHRNRSIQLRVLYGPTIDRAKCPQRLMWKEKTMH
ILQCQARGNPNPQLQCLREGSKFKVPVGIPFLVLLNYSGTYSCQAASSRGTDKMLVMMDV
QGRNPVTINIVLGVLAILGLVTLAAASVYVFWVQRQHDIYHLTPRSTRWRLTSTQPVTVA
EELS
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgatgccctcagggccaccacccagggtctactggacttcgctcatctttctgcttctt
gcctgctgtctgttgcccacaggtgcccagggacagacctaccaggtacgagtggagccg
aaggacccagtggtgccttttggagagcccctcgtggtaaactgcaccttagattgcccc
gggcctggattaatctccctggagacagccctctccaaggagccccacagcaggggcctg
ggctgggcagccttccgtctcaccaacgtgactggcgacatggaaattctctgctctggc
atctgcaataagtcccaggtggtgggtttctctaacatcacagtgtttgggtttccaaag
cgtgtggagctggcacccctgcccctctggcagcctgtgggtgaagaactcaacctgagc
tgcctggtgtctggcggggccccccgggcccacctctccgtggtgctgctccgaggggag
gaggagctgggccggcagcccttgggaaaggaggagcccgccaaggtcacgttcatggtg
cagccgagaagagaggaccatggcaccaatttctcctgccgctctgaactggacctgcgg
tcccaaggactggaactcttccagaacacctcggcccccaggaagctccagacctatgcc
atgcccaagaccgccccgcgcctcgttttccctcggttctgggagatggaaacctcctgg
cctgttaactgcagcctggatgggctgttcccagcgtcggaggcccatattcaactggcg
ctggggaaccagatgctgaatgccacagtagtgagccacgcggacacgctcacggccaca
gccacagcgaaaaccgaacaggagggcacccaagagattgtctgcaacgtaaccttgggg
gtsgagaaccgagagacccgggagagcttggttgcctatagattccaggggcccaacctg
aacctgagtgagtctaacgccaccgaggggaccccagtgactgtcacttgcgcggccgga
ccccaagtccaggtcatgctggacggagttccagccgcggtaccaggacagcctgcccag
cttcagctaaaggccaccgagatggacgacaggcgcaccttcttctgcaatgccaccctc
aaggtgcatggggtgacattgcaccgtaataggagcatccagttgcgtgtcctgtacggc
cccacgattgacagagctaaatgtccccaacgcttgatgtggaaagaaaagactatgcat
atcctgcagtgccaggcccggggcaacccgaacccccagctacagtgtctgcgggaaggc
tccaagtttaaggtgcccgtcgggattccattcctcgtcttgttaaactacagtggtacc
tacagctgccaggcggccagttcacggggcacggacaaaatgttagtgatgatggacgtt
caaggtcggaacccggtcactatcaacatcgtcctgggagtgttagcgatcttgggcttg
gtgactctcgctgcagcctcagtgtacgtcttttgggtgcagaggcaacatgacatttac
cacctgacgccaaggagcacccggtggcgcctcacgtctacacagcccgtgactgtggca
gaggagttatcctga

KEGG   Bos indicus (zebu cattle): 109573936
Entry
109573936         CDS       T04792                                 

Gene name
ICAM2
Definition
(RefSeq) intercellular adhesion molecule 2 isoform X1
  KO
K06523  intercellular adhesion molecule 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109573936 (ICAM2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109573936 (ICAM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109573936 (ICAM2)
   04091 Lectins [BR:biu04091]
    109573936 (ICAM2)
CD molecules [BR:biu04090]
 Proteins
  109573936 (ICAM2)
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109573936 (ICAM2)
SSDB
Motif
Pfam: ICAM_N PspB
Other DBs
NCBI-GeneID: 109573936
NCBI-ProteinID: XP_019837097
Position
19
AA seq 351 aa
MALTSLLPTEPASRGPKDSFRPGXKGLKPGSEIRSSPGNXGCWKLDLSHPVYPSQHHPFA
DTGSPQXFPVSLRTPPKMSPFGGWGMLAAFLAMLCCQGSGEKAFEGPEHLMVGSGEXQXI
NCTASCTDPTNLILETXLNKTLLXSQAQWKLFQVYNISKDEZLLCSFTCAGKQEMKVFNI
TVFYPPKQVLLTLSHTSVAXGTLFTIECMVPAVAPLEGLTVTLLRGTEILHNQTFEETAP
FPHDAVVTHXTTAHREDGHHNFSCEAQMDLRSRGGGLVHRVSDPQRLEVKEPEPNYQMVI
MAXVIVLLLLFVTFVXLCFVFSEKWRRGRTGHYPVQAAWNRLRRSHRAQPL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggctctgacttctctcctgccaacagagccagcatccaggggcccaaaagactccttc
agaccgggctrtaaggggctcaaacctggatcagagatcaggagcagcccaggaaacarc
ggctgctggaagctggacctcagccaccctgtttacccatcacagcatcacccgtttgct
gatacaggcagtcctcagcygttccctgtgagcctgcggacgccacccaagatgtcccct
tttggtggctggggaatgctcgcagcctttctsgctatgctctgctgccaagggtctggt
gagaaggcgttcgagggcccagagcacctgatggtggggtctggagagkttcaartgatt
aattgcactgccagttgtacggaccccacgaaccttattctagagacasmcctaaacaag
actctcctggasagccaggctcagtggaagctgttccaggtctacaacatctccaaggat
gagsagctcctgtgcagtttcacctgcgccggmaagcaggagatgaaagttttcaacatc
accgtgttctaccctccaaagcaagtgctgctgacgctgtcscacacctcagtggccrta
gggacactgttcaccatcgagtgcatggtccccgccgtggcaccccttgaaggcctcact
gtcaccctgctccgtggtactgagatcttgcacaatcagacctttgaggagacagcaccc
ttcccccacgatgccgtggtcacccacmacaccacagctcacagggaagacggccaccat
aacttctcgtgcgaggcccagatggacctgcgctctcgtggcggtggccttgtccacaga
gtctcagatccccagaggcttgaagtcaaagagcccgagcccaactatcagatggtgatc
atggcgaycgtgatagtgctgctgctcttgtttgtgacattcgtcytcctgtgctttgtc
ttcagcgagaagtggcgccgggggcggacaggtcattacccagtgcaggccgcttggaac
aggctgagacggagccaccgggcacagcccctgtga

KEGG   Bos indicus (zebu cattle): 109573938
Entry
109573938         CDS       T04792                                 

Definition
(RefSeq) intercellular adhesion molecule 2-like isoform X1
  KO
K06523  intercellular adhesion molecule 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109573938
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109573938
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109573938
   04091 Lectins [BR:biu04091]
    109573938
CD molecules [BR:biu04090]
 Proteins
  109573938
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109573938
SSDB
Motif
Pfam: ICAM_N
Other DBs
NCBI-GeneID: 109573938
NCBI-ProteinID: XP_019837099
Position
19
AA seq 286 aa
MRGNTIQLTESWEFRTAAGHPFLTSALHVSPGSPQLFPANLWTPPEMSPFGGWXTLAAFL
ALLCCRGSGEEQFEVPMEPNHLLVGSGEFQVINFTASCTDPKKLVLETALHKTFLEDQAQ
WKLFKVISISKNMELMCSFICGGKEGMKVFNITXFYPPKQVLLTLSHTSVAVGTLFTIEC
XVPAVAPLEGLXVTLLXGTEILYNQTFVGTARFPQDAVVTHXTTAHREDGLHNFSCEAQM
DLRSPGGGLVHRVSDPQRLEVKEPXPSNQMVIMAXVIVLLLLFWFK
NT seq 861 nt   +upstreamnt  +downstreamnt
atgagaggaaatacgatacagcttacagaaagctgggagttccggactgccgctggtcac
cccttcctgaccagtgcccttcacgtctctccaggcagtcctcagctgttccctgcaaac
ctgtggacgccacccgagatgtccccttttggtggctgggraacgctcgcagcctttctc
gccctgctctgctgccgaggttctggtgaggagcagttcgaggtacccatggagccaaac
cacctgttggtggggtctggagagtttcaggtgattaattttactgccagttgtacrgac
cccaagaaacttgttctggagacagccctacacaagactttcctggaggaccaagctcag
tggaagttgttcaaggtcatcagcatctccaagaacatggagctcatgtgcagtttcatc
tgcggcggcaaggaggggatgaaagttttcaacatcaccktgttctaccctccaaagcaa
gtgctgctgacgctgtcgcacacctcagtggccgtagggacactgttcaccatcgagtgc
akggtcccygccgtggcacccctcgaaggcctcastgtcaccctgctcygtggtactgag
atcttgtacaatcagacctttgtggggacagcacgtttcccccaagatgccgtggtcacc
cacmacaccacagctcacagggaagacggcctccataacttctcgtgcgaggcccagatg
gacctgcgctctcctggcggtggccttgtccacagagtctcagatccccagaggcttgaa
gtcaaagagcccgwgcccagcaaccagatggtgatcatggcgawcgtgatagtgctgctg
ctcttgttctggttcaaataa

DBGET integrated database retrieval system