KEGG   Bos indicus (zebu cattle): 109561585
Entry
109561585         CDS       T04792                                 

Gene name
ICAM3
Definition
(RefSeq) intercellular adhesion molecule 3
  KO
K06486  intercellular adhesion molecule 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109561585 (ICAM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109561585 (ICAM3)
   04091 Lectins [BR:biu04091]
    109561585 (ICAM3)
CD molecules [BR:biu04090]
 Proteins
  109561585 (ICAM3)
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109561585 (ICAM3)
SSDB
Motif
Pfam: ICAM_N Ig_2 C2-set_2 Ig_3
Other DBs
NCBI-GeneID: 109561585
NCBI-ProteinID: XP_019819699
Position
7
AA seq 544 aa
MMPSGPPPRVYWTSLIFLLLACCLLPTGAQGQTYQVRVEPKDPVVPFGEPLVVNCTLDCP
GPGLISLETALSKEPHSRGLGWAAFRLTNVTGDMEILCSGICNKSQVVGFSNITVFGFPK
RVELAPLPLWQPVGEELNLSCLVSGGAPRAHLSVVLLRGEEELGRQPLGKEEPAKVTFMV
QPRREDHGTNFSCRSELDLRSQGLELFQNTSAPRKLQTYAMPKTAPRLVFPRFWEMETSW
PVNCSLDGLFPASEAHIQLALGNQMLNATVVSHADTLTATATAKTEQEGTQEIVCNVTLG
VENRETRESLVAYRFQGPNLNLSESNATEGTPVTVTCAAGPQVQVMLDGVPAAVPGQPAQ
LQLKATEMDDRRTFFCNATLKVHGVTLHRNRSIQLRVLYGPTIDRAKCPQRLMWKEKTMH
ILQCQARGNPNPQLQCLREGSKFKVPVGIPFLVLLNYSGTYSCQAASSRGTDKMLVMMDV
QGRNPVTINIVLGVLAILGLVTLAAASVYVFWVQRQHDIYHLTPRSTRWRLTSTQPVTVA
EELS
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgatgccctcagggccaccacccagggtctactggacttcgctcatctttctgcttctt
gcctgctgtctgttgcccacaggtgcccagggacagacctaccaggtacgagtggagccg
aaggacccagtggtgccttttggagagcccctcgtggtaaactgcaccttagattgcccc
gggcctggattaatctccctggagacagccctctccaaggagccccacagcaggggcctg
ggctgggcagccttccgtctcaccaacgtgactggcgacatggaaattctctgctctggc
atctgcaataagtcccaggtggtgggtttctctaacatcacagtgtttgggtttccaaag
cgtgtggagctggcacccctgcccctctggcagcctgtgggtgaagaactcaacctgagc
tgcctggtgtctggcggggccccccgggcccacctctccgtggtgctgctccgaggggag
gaggagctgggccggcagcccttgggaaaggaggagcccgccaaggtcacgttcatggtg
cagccgagaagagaggaccatggcaccaatttctcctgccgctctgaactggacctgcgg
tcccaaggactggaactcttccagaacacctcggcccccaggaagctccagacctatgcc
atgcccaagaccgccccgcgcctcgttttccctcggttctgggagatggaaacctcctgg
cctgttaactgcagcctggatgggctgttcccagcgtcggaggcccatattcaactggcg
ctggggaaccagatgctgaatgccacagtagtgagccacgcggacacgctcacggccaca
gccacagcgaaaaccgaacaggagggcacccaagagattgtctgcaacgtaaccttgggg
gtsgagaaccgagagacccgggagagcttggttgcctatagattccaggggcccaacctg
aacctgagtgagtctaacgccaccgaggggaccccagtgactgtcacttgcgcggccgga
ccccaagtccaggtcatgctggacggagttccagccgcggtaccaggacagcctgcccag
cttcagctaaaggccaccgagatggacgacaggcgcaccttcttctgcaatgccaccctc
aaggtgcatggggtgacattgcaccgtaataggagcatccagttgcgtgtcctgtacggc
cccacgattgacagagctaaatgtccccaacgcttgatgtggaaagaaaagactatgcat
atcctgcagtgccaggcccggggcaacccgaacccccagctacagtgtctgcgggaaggc
tccaagtttaaggtgcccgtcgggattccattcctcgtcttgttaaactacagtggtacc
tacagctgccaggcggccagttcacggggcacggacaaaatgttagtgatgatggacgtt
caaggtcggaacccggtcactatcaacatcgtcctgggagtgttagcgatcttgggcttg
gtgactctcgctgcagcctcagtgtacgtcttttgggtgcagaggcaacatgacatttac
cacctgacgccaaggagcacccggtggcgcctcacgtctacacagcccgtgactgtggca
gaggagttatcctga

DBGET integrated database retrieval system