KEGG   Bos indicus (zebu cattle): 109561633Help
Entry
109561633         CDS       T04792                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04072  Phospholipase D signaling pathway
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04520  Adherens junction
biu04910  Insulin signaling pathway
biu04913  Ovarian steroidogenesis
biu04923  Regulation of lipolysis in adipocytes
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease (NAFLD)
biu04960  Aldosterone-regulated sodium reabsorption
Module
biu_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109561633 (INSR)
   04015 Rap1 signaling pathway
    109561633 (INSR)
   04010 MAPK signaling pathway
    109561633 (INSR)
   04066 HIF-1 signaling pathway
    109561633 (INSR)
   04068 FoxO signaling pathway
    109561633 (INSR)
   04072 Phospholipase D signaling pathway
    109561633 (INSR)
   04022 cGMP - PKG signaling pathway
    109561633 (INSR)
   04151 PI3K-Akt signaling pathway
    109561633 (INSR)
   04152 AMPK signaling pathway
    109561633 (INSR)
   04150 mTOR signaling pathway
    109561633 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109561633 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109561633 (INSR)
   04923 Regulation of lipolysis in adipocyte
    109561633 (INSR)
   04913 Ovarian Steroidogenesis
    109561633 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109561633 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    109561633 (INSR)
   04213 Longevity regulating pathway - multiple species
    109561633 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    109561633 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109561633 (INSR)
   04931 Insulin resistance
    109561633 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109561633 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:biu04090]
    109561633 (INSR)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109561633 (INSR)
Protein kinases [BR:biu01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   109561633 (INSR)
CD molecules [BR:biu04090]
 Proteins
  109561633 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 109561633
NCBI-ProteinID: XP_019819784
Position
7
AA seq 914 aa AA seqDB search
MEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSYDKILLKWEPYWPPDFRDLL
GFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPTRSNDPKSQNHPGWLMRGLKPWTQ
YAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDP
NGNITHYLVFWERQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQSEYEESAGE
CCSCPKTDSQILKELEESSFRKTFEDYLHNVVFIPRKSSSGPVAEDARPSRKRRALGDVG
NVTAAVPTALGLPNTSSTSTPMSSEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQD
SPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSY
RRYGEEELHLCVSRRHYALERGCRLRGLLPGNYSVRVRATSLAGNGSWTEATYFYVTDYL
DVPSNIAKIIIGPLIFVFLFSVVIGSICLFLRKRQPDGPLGPLYASSNPEYLSASDVFPC
SVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVKTVNESASLRER
IEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGR
PPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETD
YYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKF
VMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEE
NKAPESEELEMEFEDMESVPLDRASHAQREEAGGRDGGSALGLKRNYDEHIPYTHMNGGK
KNGRILTLPRSNPS
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagtttcaggaaccaaggggcgccaggagagaaatgacattgctctaaagacc
aatggggaccaggcatcctgtgaaaatgaattacttaaattttcttacattcggacatct
tacgacaagatcttgctgaaatgggagccgtattggcctcctgacttccgagacctcctg
gggttcatgttgttctacaaagaggccccttaccagaacgtgacagaattcgatgggcag
gatgcgtgcggctccaacagctggacagtggtggatattgacccgcctacgaggtccaac
gaccccaagtcacagaaccaccctgggtggctgatgcgtggtctcaagccctggacccag
tatgccatctttgtcaagaccctggtcaccttttctgatgaacgccgtacatacggggcc
aagagtgacatcatctatgtccagacagacgccactaatccttccgtgcccctggatccc
atctcagtttctaattcctcgtcccagattattctgaagtggaagcctccctccgacccc
aatggcaatatcacacactacttggtgttctgggagagacaggcggaagacagtgagctg
tatgaactggattattgcctcaaagggttgaagctgccctcccggacctggtctccacca
ttcgagtcggagggctcccagaagcacaaccagagtgagtatgaggagtctgctggcgaa
tgctgctcctgcccaaagaccgactcgcagatcctcaaggagctggaggagtcctcgttc
aggaaaacgtttgaagattacctgcacaacgtggttttcatccccagaaaatcatcttca
ggccctgttgccgaggacgctaggccttcgaggaaacgcagagcccttggtgaygtgggg
aatgtgacagcagccgtgcccaccgctctggggctccccaatacctcctccaccagcacg
cccatgagctcggaggagcacagacccttcgagaaagtggtgaacaaggagtcgctggtc
atctccggcctgcgtcactttactggctatcgcatcgagcttcaggcctgcaaccaagat
tcccccgaggagaggtgtagcgtggctgcctatgtcagcgccaggacgatgcctgaagcc
aaggcagatgatattgtcggccccgtgacccatgaaatcttcgagaacaacgttgttcac
ttgatgtggcaggagcccaaggaacccaacggtctgattgtgctgtatgaagtgagttac
cgacgatacggcgaggaggagctgcacctctgcgtctcccgccgacattatgctctggag
cgtggctgccggctgcgtgggctgctgcctgggaattacagtgtgcgagttcgggccacc
tccctggcaggcaatgggtcttggacggaagccacctatttctacgtgacagactattta
gacgtgccatcaaatattgcaaaaatcatcatcggtcccctcatctttgtctttctcttc
agtgttgtgattggaagtatttgtctattcctgagaaagaggcagccagatgggccattg
ggaccactgtatgcttcttcaaacccagagtacctcagtgccagcgatgtgtttccatgc
tctgtgtatgtgccggacgagtgggaggtgcctcgagagaagatcacactcctgcgagaa
ttggggcaaggctcctttggcatggtgtacgagggcaacgccagggacattgtcaagggt
gaggcggagacgcgcgtggcagtgaagacggtcaacgagtcagccagcctgcgagagcgg
atcgagtttctcaacgaggcttcggtcatgaagggcttcacctgccaccatgtggtccgc
ctcctgggggtggtgtccaaaggccagccaacgctggtggtgatggagttgatggctcac
ggagacctgaagagttacctccgttccctgcggcctgaggctgagaataaccccggccgc
cctccgcctaccctgcaagaaatgattcagatggcggcagagatcgccgatgggatggca
tacctgaacgctaagaagttcgtgcaccgggatcttgcagcccggaactgcatggttgcc
cacgactttacagtcaaaattggagactttggaatgacaagagacatctatgaaacggat
tactaccggaaagggggcaaaggtctgctccccgtgcggtggatggcacctgaatccctg
aaggacggagtcttcaccacctcttcagacatgtggtcttttggtgtggtcctttgggaa
attaccagcttggcagaacagccttaccaaggtctatcaaatgagcaggtgctgaaattt
gtcatggatggagggtacctggatcaacctgacaattgtccagagagagtcaccgacctg
atgcggatgtgctggcagttcaaccccaagatgcgtccaaccttcctggagatcgtggac
ctgctcaaggacgacctgcaccccagctttcccgaagtgtccttcttccacagcgaggag
aacaaggcgcccgagagcgaggagctggaaatggagtttgaggacatggagagcgtgccc
ctggaccgggcctcgcacgcgcagagagaggaggccgggggccgggatggagggtcggcg
ctggggctaaagcgaaactatgacgagcacatcccctacacccacatgaacgggggcaag
aaaaacggacggattctgactttgccccggtcaaatccttcctaa

DBGET integrated database retrieval system