KEGG   Bos indicus (zebu cattle): 109561686
Entry
109561686         CDS       T04792                                 

Gene name
C3
Definition
(RefSeq) complement C3
  KO
K03990  complement component 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04080  Neuroactive ligand-receptor interaction
biu04145  Phagosome
biu04610  Complement and coagulation cascades
biu05133  Pertussis
biu05134  Legionellosis
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05203  Viral carcinogenesis
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109561686 (C3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109561686 (C3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109561686 (C3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109561686 (C3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109561686 (C3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109561686 (C3)
   05134 Legionellosis
    109561686 (C3)
   05150 Staphylococcus aureus infection
    109561686 (C3)
   05152 Tuberculosis
    109561686 (C3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109561686 (C3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109561686 (C3)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109561686 (C3)
   05142 Chagas disease
    109561686 (C3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109561686 (C3)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109561686 (C3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109561686 (C3)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   109561686 (C3)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109561686 (C3)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109561686 (C3)
SSDB
Motif
Pfam: TED_complement MG1 A2M A2M_BRD A2M_recep MG4 NTR MG2 MG3 ANATO
Other DBs
NCBI-GeneID: 109561686
NCBI-ProteinID: XP_019819888
Position
7
AA seq 1661 aa
MKPTSGPSLLLLLLASLPMALGNPMYSMITPNILRLESEETVVLEAHGGQGTIQVSVTVH
DFPAKKQVLSNENTQLNSNNGYLSTVTIKIPASKELKSDKGHKFVTVVATFGNVQVEKVV
LISLQSGYLFIQTDKTIYTPGSTVLYRVFTVDHKLLPVGQTVFITIETPDGIPVKRDSKS
SQNQFGILTLSWNIPELVNMGVWKIKAYYEDSPQQVFSAEFEVKEYVLPSFEVQLEPEEK
FYYIDDPDGLKVNIIARFLYGEQVDGTAFVIFGVQDGDRRISLTHSLTRVPINDGNGEAI
LKRQVLLNGVQPSRADALVGKSIYVSATVILQSGSDMVEAERTGIPIVTSPYQIHFTKTP
KFFKPAMPFDLMVYVTNPDGSPARHIPVVTQGSNVQSLTQDDGVAKLSINTQNKRDPLTI
TVRTKKDNIPEGRQATRTMQALPYNTQGNSNNYLHLSVPRVELKPGETLNVNFHLRTDPG
EQAKIRYYTYMIMNKGKLLKVGRQYREPGQDLVVLPLTITSDFIPSFRLVAYYTLINAKG
QREVVADSVWVDVKDSCMGTLVVKNGGKEEKHHRPGQQITLKIEADQGARVGLVAVDKGV
FVLNKKNKLTQRKIWDVVEKADIGCTPGSGRNYAGVFTDAGLTLKTSQGLETQQRADPQC
PQPATRRRRSVQLMEKRMDKAGQYXSDLRKCCEDGMRDNPMKFPCQRRAQFILQGDACVK
AFLDCCEYITQLRQQHSRDGALELARSDLDDDIIPEEDIISRSQFPESWLWTVIEDLKQA
DKNGISTKLMNVFLKDSITTWEILAVSLSDKKGICVADPYEVTVMQDFFIDLRLPYSVVR
NEQVEIRAILYNYREAENLKVRVELLYNPAFCSLATAKKRHQQTITIPARSSVAVPYVIV
PLKIGLHEVEVKAAVYNHFISDGVKKTLKVVPEGVRVNKTVAVRTLNPEHLGQGGVQREE
VPAADLSDQVPDTESETKILLQGTPVAQMTEDAIDGERLKHLIQTPSGCGEQNMIGMTPT
VIAVHYLDSTDQWEKFGLEKRQESLELIRKGYTQQLAFRQKSSAYAAFQYRPPSTWLTAY
VVKVFALAANLIAIDSKDLCETVKWLILEKQKPDGIFQEDGPVIHQEMIGGFRDTREKDV
SLTAFVLIALHEAKDICEAQVNSLGRSIAKAGDFLEXHYRELRRPYTVAIAAYALALLGK
LEGDRLTKFLNTAKEKNRWEEPNQKLYNVEATSYALLALLVRKDYDTTPPVVRWLNEQRY
YGGGYGSTQATFMVFQALAQYQKDVPDHKELNLDVSIQLPSRNSAVRHRILWESASLLRS
EETKENERFTVKAEGKGQGTLSVVTVYHAKLKGKVSCKKFDLRVSIRPAPETVKKPQDAK
GSMILDICTKYLGDQDATMSIXDISMMTGFSPDVEDLKTLSTGVDRYISKYEMNRDSNKN
TLIIYLDKVSHTVEDCLSFKVHQYFNVGLIQPGAVKVYSYYNLDETCIRFYHPDKEDGML
SKLCHKDTCRCAEENCFMHHTEKEVTLEDRLDKACEPGVDYVYKTRLIQKKLEDDFDEYI
MVIENIIKSGSDEVQVKQERKFISHIKCREALKLKEGAHYLVWGVSSDLWGEKPKISYII
GKDTWVELWPEAEECQDEENQKQCEDLANFTENMVVFGCPN
NT seq 4986 nt   +upstreamnt  +downstreamnt
atgaagcccacctcaggccccagcctgctgctgctgcttctagccagtctccccatggcc
ctggggaaccccatgtattccatgatcacccccaacatcctgcgtctggagagcgaggag
actgtggtgctggaggcccacggaggacaagggactattcaggtctcggtcaccgtccac
gacttcccggccaagaaacaagtgctgtcaaacgaaaacacccagctgaacagcaacaat
ggctacctgagcaccgtcaccatcaagatcccggccagcaaagagttaaaatccgacaag
gggcacaagttcgtgactgtcgtagcgaccttcgggaatgtccaggtggagaaggtggtg
ctgatcagccttcagagcgggtacctcttcatccagacggacaagaccatctacacccca
ggctccacggtcctctatcgggtcttcactgttgaccacaagctgctgcccgtgggccag
acggttttcatcaccatcgagacccctgatggcatccctgtcaagcgggactccaagtct
tctcagaaccagtttggcattttgaccttgtcctggaacattccagagctagtgaacatg
ggggtgtggaagatcaaagcctactatgaagattctccgcagcaggtcttctccgctgag
tttgaggtgaaggaatatgtgcttcccagttttgaggtccaactagagcctgaagagaaa
ttctactacattgatgacccagatggcctgaaggtcaacatcattgccaggttcttgtac
ggggaacaggtggacggaacagctttcgtcatctttggggtccaggatggcgaccggaga
atttcattgactcactccctcacccgtgttccgatcaacgatggtaatggggaggccata
ctgaaacgtcaggttttgctgaatggagtacagccctcccgagctgatgccctggtgggc
aagtccatatatgtgtccgccaccgtcatcttgcaatcaggcagtgacatggtggaggca
gagcgcaccgggatccccattgtgacttccccctaccagatccatttcaccaagaccccc
aagttcttcaaacctgccatgcccttcgacctcatggtgtacgtgacaaaccccgacggc
tcccccgctcgccacatcccggtggtgacccagggcagcaatgtgcagtccttgacccag
gatgatggcgtggccaagctaagcatcaacacacagaacaaacgggatcccctgaccatc
accgtacgcacaaaaaaggacaatatcccygaggggcgacaggccaccaggaccatgcag
gccctaccctacaacacccaggggaactccaataactacctgcacctctctgtgccccgc
gtggagctcaagcctggggagactctcaacgtcaacttccacctgcgcacggaccccggc
gagcaagccaagatccgctactacacctacatgatcatgaacaaggggaagctgttgaag
gtgggacgccagtaccgagagcccggccaggacctagtggtrttgcccttgaccatcacg
tcagacttcatcccttccttccgcctggtggcctattacacactgattaatgccaaaggc
cagagggaggtggtggccgactccgtgtgggtggatgtcaaggactcgtgtatgggcacg
ctggtggtgaaaaatggtgggaaggaagagaaacaccatcgacccgggcaacagataacc
ctgaagatcgaggctgaccagggggcccgagtggggctcgtggccgtggacaagggcgtg
tttgtgctgaataagaagaacaaattgacccagagaaagatctgggacgtggtggagaaa
gcggacattggctgcaccccaggcagtggaagaaactatgctggcgtcttcacggatgca
ggactcactctcaagaccagccagggcctggagacccagcagagggcagatccgcagtgc
ccgcaaccagccacccgccgacgccgctcggtgcagctcatggagaagaggatggataaa
gcgggtcagtacarcagcgatctgcgcaagtgctgcgaagacggcatgcgggacaacccc
atgaagttcccgtgccagcgccgggcccagttcatcctgcagggcgacgcgtgcgtcaag
gccttcctggactgctgcgagtacatcactcagctgcggcagcagcacagccgcgacggc
gccctggagctggccaggagtgacctggatgatgacataatcccagaggaggacatcatt
tcccgaagccaattcccygagagctggttgtggaccgtcattgaggaccttaaacaagca
gacaaaaatggaatctccacgaagctcatgaacgtgtttttgaaagactccatcaccact
tgggagattctggccgtgagcttgtcagacaagaaagggatctgtgtggctgacccctat
gaggtcactgtgatgcaggatttctttatcgacctgcgtctcccctactcggtggtgcgc
aacgagcaagtggagatccgagcgatcctctacaactaccgggaggcggaaaatctcaag
gtgagggtggaattgctctacaatccagccttctgtagcctggccaccgccaagaagcgc
caccagcagactataacgatcccagccaggtcctcggtggcggtgccttacgtcattgtg
cccctgaagatcggcctccacgaggtggaggtcaaggctgccgtctacaaccacttcatc
agtgatggtgtcaagaagaccctgaaggtcgtgccagaaggcgtaagagtcaacaaaact
gtggctgttcgtacactgaatccagaacatctgggtcaagggggagtgcagcgagaggaa
gtcccagctgcagatcttagtgatcaagtcccagacaccgagtcagagaccaagatcctc
ctgcaggggactccggtggcccaaatgacggaggacgccatcgacggagagcggctgaag
caccttatccaaaccccctccggctgtggggagcagaacatgattggtatgacgcccacg
gtcatcgccgtgcactacctggacagcaccgaccagtgggagaagttcggcttggagaag
cggcaggagtccctggagctcatcagaaaggggtacacccagcagctggccttcagacaa
aagagctcagcctacgccgccttccaatatcggccccccagcacctggctgacagcctac
gtggtcaaggtctttgcactggccgccaacctcatcgccatagactccaaggacctctgt
gagaccgtcaaatggctgatcctggagaagcagaagcctgatggaatcttccaggaggat
gggcctgtgatacaccaagaaatgattggtggcttcagggacaccagggagaaagatgtg
tcccttacagcctttgttctcatcgcgctgcacgaggctaaagacatttgcgaggcacag
gtcaacagcctgggccgcagcatcgctaaggcaggagacttcctygaaamccactacaga
gagttgcgaagaccatatactgtggccattgctgcctatgccctggctttgttgggcaag
ctggagggtgaccgcctcaccaaatttctgaacacagccaaagaaaagaaccgctgggag
gaacccaaccagaagctctacaatgtggaggccacgtcctacgccctcttggctctgctg
gtacgcaaagactacgacactacgcctcctgtcgtgcgctggctcaacgaacagagatac
tatggaggtggttatggctccacgcaggccactttcatggtgttccaagccttggcccaa
taccagaaggatgttcctgatcacaaggagctgaacctggatgtgtccatccaactgccc
agccgcaactctgcggtcaggcatcgtatcctctgggaatctgccagcctcctgcgctca
gaagagactaaggaaaatgagcgtttcacagtaaaagctgaagggaaaggacaaggcacc
ttgtcggtagtgaccgtgtaccatgccaagctcaaaggcaaagtctcctgcaaaaagttc
gacctccgggtttccatacgcccagcccccgaaacagtcaagaagcctcaggacgccaaa
ggttccatgatccttgacatctgtaccaagtacctgggagaccaggatgccactatgtcc
atcntggatatatccatgatgacaggcttctcacctgatgttgaagacctcaaaacgctg
agcactggtgtcgacagatacatctctaagtatgagatgaacagagactccaacaagaac
acactcatcatctacctggacaaggtctcacacacagtggaggactgtctgtccttcaaa
gttcaccagtactttaatgtcggacttatacagcctggggcagtcaaggtgtactcctat
tacaacctggatgaaacttgtatccgcttctatcacccggataaagaggacggaatgctg
agcaaactctgccacaaagatacctgccgctgtgcagaggagaactgcttcatgcaccac
acggagaaggaggtcactctggaggaccggctggacaaggcttgcgagccgggcgtggac
tatgtgtacaagaccagacttatccagaagaagctggaagatgactttgacgagtacatc
atggtgatcgagaacatcatcaaatcgggctcggacgaggtgcaggttaaacaggagcgc
aagttcatcagccacatcaagtgcagggaagcccttaaactgaaggagggggcacactat
ctcgtgtggggcgtgtcctctgacctgtggggcgagaaacccaagatcagctacatcatc
gggaaggacacctgggtggagctgtggcccgaggctgaagaatgtcaagatgaggagaac
cagaaacagtgcgaggacctggccaacttcacagagaacatggtcgtctttggctgcccc
aactga

DBGET integrated database retrieval system