KEGG   Bos indicus (zebu cattle): 109561902
Entry
109561902         CDS       T04792                                 

Gene name
F12
Definition
(RefSeq) coagulation factor XII isoform X1
  KO
K01328  coagulation factor XII (Hageman factor) [EC:3.4.21.38]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109561902 (F12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109561902 (F12)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.38  coagulation factor XIIa
     109561902 (F12)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109561902 (F12)
SSDB
Motif
Pfam: Trypsin Kringle fn2 EGF fn1 Trypsin_2 EGF_2 hEGF DUF1986
Other DBs
NCBI-GeneID: 109561902
NCBI-ProteinID: XP_019820267
Position
7
AA seq 603 aa
MRALLLLGALLVSLESTVSTPPWKGPKKHKLTESEHTVVLTVTGEPCHFPFQYHRQLHHK
CIHRGRPGPRPWCATTPNFEKDQRWAYCLEPKKVKDHCSKHNPCQKGGTCVNMPDGPRCI
CADHFTGKHCQKEKCFEPQFFRFFHENEIWHRLEPAGVVKCQCKGPNAQCKPLASQVCRT
NPCLNGGSCLQAEGHRLCRCAPSFAGRLCDVDLKASCYDDRDRGLSYRGMAGTTLSGAPC
QSWASEATYWNVTAEQVLNWGLGDHAFCRNPDNDTRPWCFIWKGDRLSWNYCRLAPCQAA
AGHEHFPLPSPSALQKPESTTQTPLPSLTSGWCSPTPLASGGPGGCGQRLRKWLSSLNRV
VGGLVALPGAHPYIAALYWDQHFCAGSLIAPCWVLTAAHCLQNRPAPKELTVVLGQDRHN
QSCEQCQTLAVRDYRLHEAFSPITYQHDLALVRLQESADGCCAHPSPFVQPVCLPSTAAR
PAESEAAVCEVAGWGHQFEGGEYSSFLQEAQVPLIDPQRCSAPDVHGAAFTQGMLCAGFL
EGGTDACQGDSGGPLVCEDETPERQLILRGIVSWGSGCGNRLKPGVYTDVANYLAWIREH
TAS
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgagggctctgctgctcctgggggccctgctggtgagcctggagtcaacggtttcgact
ccaccttggaagggccccaagaagcataagctcacagagagtgagcacacagtggttctc
actgtcaccggggaaccctgccacttccccttccagtaccaccggcagctgcatcataaa
tgcatccacagaggccggccaggcccccgaccttggtgtgctactacccccaactttgag
aaggaccaacgatgggcatactgcctggagcccaagaaagtgaaagaccactgcagcaaa
cacaatccctgccagaagggagggacctgtgtgaacatgccggatggcccacgctgcatc
tgtgcagatcacttcactgggaagcactgccagaaagagaagtgctttgagccccagttt
ttccggttcttccatgagaatgaaatatggcataggcttgagccagcaggtgtggtcaag
tgccagtgcaagggtccgaatgcccaatgcaagccactggccagccaggtctgccgcacc
aacccgtgtctcaacgggggcagctgcctgcaggcggagggccatcgcctgtgccgttgt
gcccctagcttcgcgggacgtttgtgcgatgtagacctcaaggcgagttgctacgacgac
cgcgaccgcggtctcagctaccgcggcatggcggggactacgctgtccggcgcaccctgt
cagtcgtgggcctccgaggccacctactggaatgtgaccgcagagcaagtgctgaactgg
ggactgggcgaccacgccttctgccggaaccccgacaacgacacccgcccttggtgcttc
atttggaaaggcgaccgactgagctggaattactgccgcctggcaccgtgccaggccgca
gctgggcacgagcacttccccttgccctcgccatcggctttgcagaaacctgagtccacg
acccagaccccgcttccatccctgacttcaggctggtgctcgccgactcctctggccagc
ggaggccccgggggctgtggccagcggctccgcaaatggctgtcctcgctgaaccgcgtc
gtcggaggactggtggcgctccccggggcgcacccctacatcgccgcgctgtactgggac
caacatttctgcgccggcagcctcatcgctccctgttgggtgctgactgcggctcactgt
ctgcagaaccgacccgcgccgaaggagctgaccgtggtgctcggccaggaccgccacaac
cagagctgtgagcagtgccagacgctggcagtgcgggactaccgcctgcacgaggccttc
tcgcccatcacctaccagcacgacctggctctggtgcgcctgcaggagagcgcggacggc
tgctgcgcgcacccgtcgcctttcgttcagccagtgtgcctgccgagtaccgccgcccgc
cccgccgaatccgaagccgcagtctgcgaggtggccggctggggtcaccagttcgagggt
ggggaatattccagcttcctgcaggaggctcaggtgccactcatcgacccgcagcgctgc
tccgcccccgacgtgcacggagcagccttcacccagggcatgctctgcgctggcttcctc
gagggcggcaccgacgcatgccagggtgactccggaggccctctagtgtgtgaggatgag
acccctgagcgccagctcatcctgcgaggcatagtcagctggggctcaggttgyggcaac
cgcctcaagccaggtgtgtacacagacgtggccaactacctagcctggattcgggagcac
accgcttcctga

DBGET integrated database retrieval system