KEGG   Bos indicus (zebu cattle): 109561936
Entry
109561936         CDS       T04792                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
biu04145  Phagosome
biu04218  Cellular senescence
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04940  Type I diabetes mellitus
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109561936
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109561936
   04145 Phagosome
    109561936
  09143 Cell growth and death
   04218 Cellular senescence
    109561936
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109561936
   04612 Antigen processing and presentation
    109561936
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109561936
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109561936
   05330 Allograft rejection
    109561936
   05332 Graft-versus-host disease
    109561936
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109561936
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109561936
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109561936
   05170 Human immunodeficiency virus 1 infection
    109561936
   05168 Herpes simplex virus 1 infection
    109561936
   05163 Human cytomegalovirus infection
    109561936
   05167 Kaposi sarcoma-associated herpesvirus infection
    109561936
   05169 Epstein-Barr virus infection
    109561936
   05165 Human papillomavirus infection
    109561936
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109561936
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109561936
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109561936
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Antigens
  109561936
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3
Other DBs
NCBI-GeneID: 109561936
NCBI-ProteinID: XP_019820347
Position
7
AA seq 396 aa
MWLRSSGSAQHPRPPPPPSLLRLLLLLSGLVQKGAAESPWGLPLVADGPASMAKVVMAEL
ANLKLENKSWPRVCVSTGTHSLRYHYLDLSEPDPSLPKFQAVGYLDDQPFIRYDSHVDKA
EPQAPWIMPMNAKYWEKETKKQKKWAELHQVETWQMMGYHNHSSGMHSTHRMFGCEIQEN
GHSNSFWQFGYDGQDHVSLDMETLSWVSANPVALLTKRRMETEHCYAEYNKAYLEGPCLA
SLXRYLELGGQRFTRREPPTVWVTKHSAQDGGTTLRCWALGFYPQDITLSWWLGEKKLNS
KLEYVEARPSGDGTYQTWMAVWVPAGDETQYTCHVQHCSLNHTLTVSWEMPSHPGLTAMV
ISLILILLVIGGGVSLTKCLQARNKEPYEQPPGDCG
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgtggcttcgtagttccgggagtgcgcagcacccgcggccgccgccaccaccatcactg
ctgcggctgctgctactgctgtcaggactggtgcaraagggagcggcagagagtccctgg
gggttgcccttggtggccgatggcccagcttccatggcaaaggtggtgatggcagaactg
gcaaacctgaagttggaaaacaagtcatggcctagagtttgtgtttccacagggacgcac
tccctccgctaccactacctggacctgtcagagccggacccgagcctccctaagtttcag
gctgtaggctacttggatgatcagccttttatccggtatgacagtcatgtggacaaagct
gagccccaggctccatggattatgcccatgaatgccaagtactgggagaaggagaccaag
aagcagaagaaatgggcagagcttcatcaggtggagacatggcaaatgatgggctaccac
aaccacagcagcggcatgcacagcactcaccgcatgtttggctgtgagatccaggaaaat
ggccactccaacagcttctggcagtttggctatgatgggcaagaccacgtgtcactggac
atggaaactctgagttgggtgtcagctaaccccgtggctctgttgaccaagcgtagaatg
gagacagagcactgctatgctgagtacaacaaagcctacctggaaggcccctgcctcgcc
tccctgcrcagatacctggagctgggaggccagagattcacccggagagaaccacccaca
gtatgggtgacaaagcactcagcccaggacgggggtaccaccctgaggtgctgggccctg
ggcttctatccacaagacatcacactgagctggtggctgggtgagaagaagttgaattca
aagcttgagtatgtggaggcacgccccagtggagatggcacctatcagacgtggatggcg
gtgtgggtgccggctggagatgagacccaatacacatgccacgtgcagcactgcagcctg
aatcacacactcactgtgtcctgggaaatgccctctcatccaggacttacggccatggtt
atctctctcatcctgatcttgctggtgattggtggtggtgtgagtttgaccaagtgcctt
caagccaggaataaggaaccttacgagcaacccccaggtgactgtggttaa

KEGG   Bos indicus (zebu cattle): 109576723
Entry
109576723         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: BOLA class I histocompatibility antigen, alpha chain BL3-6-like
  KO
K06751  MHC class I antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
biu04145  Phagosome
biu04218  Cellular senescence
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04940  Type I diabetes mellitus
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109576723
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109576723
   04145 Phagosome
    109576723
  09143 Cell growth and death
   04218 Cellular senescence
    109576723
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109576723
   04612 Antigen processing and presentation
    109576723
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109576723
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109576723
   05330 Allograft rejection
    109576723
   05332 Graft-versus-host disease
    109576723
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109576723
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109576723
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109576723
   05170 Human immunodeficiency virus 1 infection
    109576723
   05168 Herpes simplex virus 1 infection
    109576723
   05163 Human cytomegalovirus infection
    109576723
   05167 Kaposi sarcoma-associated herpesvirus infection
    109576723
   05169 Epstein-Barr virus infection
    109576723
   05165 Human papillomavirus infection
    109576723
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109576723
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109576723
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109576723
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Antigens
  109576723
SSDB
Motif
Pfam: MHC_I_C MHC_I C1-set PTP_tm
Other DBs
NCBI-GeneID: 109576723
NCBI-ProteinID: XP_019840922
Position
23
AA seq 257 aa
MAAQVLCCCRGHTLDHWFSGLRFWVQQESSKKKQPIAYDNNNHLARNEDLCFWTTAHAEA
QIPKLKLEQGGASGNSRNYLEGDCXVWVHRHLENGKDTLLRTDLPKTHVTHNPISGHEVP
LRFWALGFYPEEISLTWQXDMEDQTQDMELVETRPSGNGTFQKCAALVVPSEEEQRYTCN
VQCKGLQETLTLRWEPPQPAVPNIGIIVGLVLLVVAVVAGAGIWRKKXLGEKAGSYTQAA
SVDSAQGSDVSLTVPKV
NT seq 774 nt   +upstreamnt  +downstreamnt
atggctgcccaggttttgtgctgctgcagagggcacactcttgatcactggttcagtggc
ttgcgtttctgggtccaacaggagagtagcaaaaagaaacagcctattgcctatgacaac
aacaatcaccttgcccggaatgaggacctgtgcttttggaccacagcacatgcagaggct
cagatccccaagctcaagcttgagcagggtggtgcttcggggaacagtaggaactatctg
gagggggactgcrgggtgtgggtccacagacacctggagaacgggaaggacacactgctg
cgcacagaccttccaaagacacatgtgacccataaccccatctctggccatgaggtcccc
ctgaggttctgggccctgggcttctaccctgaagagatctcactgacctggcagmgtgac
atggaggaccagacccaggacatggagcttgtagagaccaggccttcggggaatggaacc
ttccagaagtgcgcagccctagtggtcccttctgaagaggagcagagatacacgtgcaat
gtgcagtgcaaggggcttcaggagaccctcacgctgagatgggaacctcctcagcccgcc
gtccccaacataggcatcattgttggcctggttctcctcgtggtggctgtggtggctggg
gctgggatatggaggaagaagcrcttaggtgaaaaagcagggagctacactcaggctgca
agcgttgacagtgcccagggctctgatgtgtctctcacggttcctaaagtgtga

KEGG   Bos indicus (zebu cattle): 109577067
Entry
109577067         CDS       T04792                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7-like isoform X1
  KO
K06751  MHC class I antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
biu04145  Phagosome
biu04218  Cellular senescence
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04940  Type I diabetes mellitus
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577067
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109577067
   04145 Phagosome
    109577067
  09143 Cell growth and death
   04218 Cellular senescence
    109577067
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109577067
   04612 Antigen processing and presentation
    109577067
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109577067
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109577067
   05330 Allograft rejection
    109577067
   05332 Graft-versus-host disease
    109577067
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577067
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577067
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577067
   05170 Human immunodeficiency virus 1 infection
    109577067
   05168 Herpes simplex virus 1 infection
    109577067
   05163 Human cytomegalovirus infection
    109577067
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577067
   05169 Epstein-Barr virus infection
    109577067
   05165 Human papillomavirus infection
    109577067
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577067
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109577067
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109577067
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Antigens
  109577067
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 MHC_I_3 ig Ig_2
Other DBs
NCBI-GeneID: 109577067
NCBI-ProteinID: XP_019841367
Position
23
AA seq 386 aa
MRVVGXRTLLLLLLLDALILTETXAGSHSLRYFYTAVSRPGLGEPRFISVGYVDDTQFVR
FDSDAPDPRIEPTARWVEQEGPEYWHQETQRTKDTAQFFRVYLNTLRGYYNQSEAGSHTV
QEMYGCDVGPDGLLRGYDQFAYDGRDYIALNEDLRSWTAADTAAQVTKHNAEAAGDAARV
RIYLEGKCVEWLRRYLVTGKDTLLRADPPKTHVAHHPISDREVTLRCWALGFYPEEISLT
WQRDGEDQTXDMELVETRPSGDGTFQKWAALVVPSGEEQRYTCHVQHEGLQEPLTLRWEP
PQPSIPIMGIIVGLVHLMVTGAMVTGAVIWRKKHSGEKGRIYSQASSSDSDQGSDVPLTV
PKGEILGHLDWERGWGRGDTLGGGGL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgcgggtcgtggggcmgagaactctcctcctgctgctgctgctggatgcgctgatcctc
actgagaccwgggcggggtcccactccctgaggtatttctacaccgccgtgtcccggccc
ggcctcggggagccccgcttcatctccgtcggctacgtggacgacacgcagttcgtgcgg
ttcgacagcgacgccccggatccgaggatagagcctacagcgcggtgggtggagcaggag
gggcccgagtactggcatcaggagacgcagagaactaaggacaccgcacaatttttccga
gtgtacctgaacaccytgcgcggctactacaaccagagcgaggccgggtctcacacmgtc
caagagatgtacggctgcgacgtggggccggacgggcttctccgcgggtatgatcagttc
gcctacgacggcagagattacatcgccctgaacgaggacctgcgytcctggaccgcggcg
gacacggcggctcaagtcaccaagcacaatgctgaggcggcaggtgatgcsgcgcgtgtg
aggatctacctggagggcaagtgtgtggagtggctccgcagatacctggtgaccgggaag
gacacgctgctgcgcgcagaccctccaaagacacatgtggcccatcaccccatctctgac
cgtgaggtcaccctgaggtgctgggccctgggcttctaccctgaggagatctcactgacc
tggcagcgtgacggggaggaccagactcasgacatggagcttgtggagaccaggccttca
ggggatggaaccttccagaagtgggcagccctggtggtgccttctggagaagagcagaga
tacacgtgccatgtgcagcacgaggggctwcaggagcccctcaccctgagatgggaacct
cctcaaccctccatccccatcatgggcatcattgttggactggttcacctcatggtcact
ggagctatggtgactggagctgtgatttggaggaagaagcactcaggtgaaaaaggacgg
atctacagccaggcttcaagcagtgacagtgaccagggctctgatgtgcctctcacggtt
cctaaaggtgagatcctggggcatctagactgggagaggggttggggcagaggggacaca
ctgggtggcgggggtctctga

KEGG   Bos indicus (zebu cattle): 109577074
Entry
109577074         CDS       T04792                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-6-like isoform X1
  KO
K06751  MHC class I antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
biu04145  Phagosome
biu04218  Cellular senescence
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04940  Type I diabetes mellitus
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577074
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109577074
   04145 Phagosome
    109577074
  09143 Cell growth and death
   04218 Cellular senescence
    109577074
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109577074
   04612 Antigen processing and presentation
    109577074
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109577074
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109577074
   05330 Allograft rejection
    109577074
   05332 Graft-versus-host disease
    109577074
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577074
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577074
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577074
   05170 Human immunodeficiency virus 1 infection
    109577074
   05168 Herpes simplex virus 1 infection
    109577074
   05163 Human cytomegalovirus infection
    109577074
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577074
   05169 Epstein-Barr virus infection
    109577074
   05165 Human papillomavirus infection
    109577074
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577074
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109577074
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109577074
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Antigens
  109577074
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 Ig_2 ig C2-set_2
Other DBs
NCBI-GeneID: 109577074
NCBI-ProteinID: XP_019841379
Position
23
AA seq 407 aa
MGPRTLLLLLLGVLVPRDTRAGPHSMRYFXTAVSRPGLGEPRFIIVGYVDDTQFVRFDSD
RPDPRMEPRARWVEDEGPEYWDQETRIQKENTQTFRANLNTLLGYYNQSEAGSHTIQWMH
GCGVGSDGRLLRGYNQLAYDCKDYLALNEDLRSWTAADTAAQITKRKWEAAGEAERFRNY
LEGECVEWLRRHLENRKDTLLRADPPKAHVAHXXSSEREVTLRCWALGFYPEEISLTWQR
NGEDQTQDMELVETRPSGDGTFQKWAALAVPSGEEQRYTCRVQHEGLQXPLTLRWGEKGR
XYTQASSSDSAQGSDVSLMVPKESWSHSSLGDPISDSSRGHFACHCPHKSRDPYTQBLSG
VKREISEPSSSCHPRNFAGFFFQLFSIFXKNHVMELAKKRDPIVFLS
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggggccgcgaaccctcctcctgctcctcttgggggtcctggtcccccgagacacacgg
gcgggccctcactccatgaggtatttcckcaccgccgtgtcccggcccggcctcggggag
ccccgcttcatcatcgtcggctacgtggacgacacgcagttcgtgcggttcgacagcgac
cgtccagatccgaggatggagccgcgggcgcggtgggtggaggatgaggggccggagtat
tgggatcaagagacgcggatacaaaaggaaaacacacagactttccgagcaaacctgaac
accctactcggctactacaaccagagcgaggccgggtctcacaccatccagtggatgcac
ggctgcggcgtggggtcggacgggcgcctcctccgcgggtataatcagctcgcctatgac
tgcaaagattacctcgccctgaacgaggacctgcgctcctggaccgcggcggacacagcg
gctcagatcaccaagcgcaagtgggaggcggcaggtgaggcggagagattcaggaactac
ctggagggcgagtgcgtggagtggctccgcagacacctggagaaccggaaggacacgctg
ctgcgcgcagaccctccaaaggcacatgtggcccatcannccagctctgagcgtgaggtc
accctgaggtgctgggccctgggcttctaccctgaggagatctcactgacctggcaacgc
aatggggaggaccagacccaggacatggagcttgtggagaccaggccttcaggggacgga
accttccagaagtgggcggccctggcggttccttctggagaggagcagagatacacgtgc
cgtgtgcagcacgaggggcttcaggrgcccctcaccctgagatggggtgaaaaaggacgg
ayctacacccaggcttcaagcagtgacagtgcccagggctctgatgtgtctctcatggtt
cctaaagagtcctggtctcattcttctctgggtgatcccatctctgacagcagcaggggt
cactttgcctgtcattgtccccacaagtcaagggatccatacacacagratctcagyggt
gtcaagagggaaatttcagagccatccagctcttgccatcctagaaattttgccggattc
ttcttccaacttttctccatctttraaaagaaccacgtgatggaacttgcaaagaagagg
gacccaatagttttcttatcttga

KEGG   Bos indicus (zebu cattle): 109577076
Entry
109577076         CDS       T04792                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7-like isoform X1
  KO
K06751  MHC class I antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
biu04145  Phagosome
biu04218  Cellular senescence
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04940  Type I diabetes mellitus
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577076
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109577076
   04145 Phagosome
    109577076
  09143 Cell growth and death
   04218 Cellular senescence
    109577076
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109577076
   04612 Antigen processing and presentation
    109577076
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109577076
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109577076
   05330 Allograft rejection
    109577076
   05332 Graft-versus-host disease
    109577076
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577076
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577076
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577076
   05170 Human immunodeficiency virus 1 infection
    109577076
   05168 Herpes simplex virus 1 infection
    109577076
   05163 Human cytomegalovirus infection
    109577076
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577076
   05169 Epstein-Barr virus infection
    109577076
   05165 Human papillomavirus infection
    109577076
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577076
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109577076
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109577076
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Antigens
  109577076
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 109577076
NCBI-ProteinID: XP_019841385
Position
23
AA seq 383 aa
MGPRTLLLLLSGVLVLTETWAGSHSLSYFNTGVYQPGLGEPRFFAVGYVDDTQFARFDSD
APNPRMEPRAPWMEQEGPEYWEEMTRDAKESQQKSRLCLYNLRGYYNQSEAESHILQVMF
GCEVGPDGRLLRGFWQKAYDGRDYIALNEDLRSWTAADTVAQITKCKWDVSGQAKIQRNY
LEVKCVQWLLRHLETGKDTLLRADPPKTHVAHHRISDREVTLRCWALGFYPKEITLTWQQ
DGEDLTQDMELVETRPSGDGTFQKWAALVVPSGEEQRYTCRVQHEGLQEPLTLRWEPPQL
SVLIKGIIVGLILLMVTGAVVTGAXIWRKKHSGEKGRGYTQTASSDSAQGSDVSLTVPKG
ETLGLLDWERSWGRGNTLGGRGL
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggggccgcgaaccctcctcctcttgctctcgggggtcctggtcctgaccgagacctgg
gccggctcccactccctgagctatttcaacaccggagtgtaccagcccggcctcggggag
ccgcgattctttgccgtcggctacgtggacgacacgcagttcgcgcggttcgacagcgac
gccccgaatccgagaatggagccgcgggcgccgtggatggagcaggagggcccggaatat
tgggaagagatgacacgagatgccaaggaaagtcaacagaaatcccgattatgcttgtac
aacctgcgcggctactacaaccagagcgaggccgagtctcacatcctccaggtgatgttt
ggctgcgaagtggggccggacgggcgcctgctccgtggattctggcagaaggcctacgac
ggcagagattacatcgccctgaacgaagacctgcgctcctggaccgcagcggacacggtg
gctcagatcaccaagtgcaagtgggatgtctccgggcaggcaaagatccaacggaactac
ctagaggtcaagtgcgtgcagtggctcctcagacacctggagacgggaaaggacacgctg
ctgcgcgcagaccctccaaagacacatgtggcccatcaccgcatctctgaccgtgaggtc
accctgaggtgctgggccctgggcttctaccctaaggagatcacactgacctggcagcaa
gacggggaagacctgactcaggacatggagcttgtggagaccaggccttcaggggatgga
accttccagaagtgggcggccctggtggtgccttctggagaggagcagagatacacgtgc
cgtgtgcagcacgaggggcttcaggagcccctcaccctgagatgggaacctcctcagctc
tctgtcctcatcaagggcatcattgttggcctgattctcctcatggtcactggagctgtg
gtgactggagctrtgatttggaggaagaagcactcaggtgaaaaaggaaggggctacacc
cagactgcaagcagtgacagtgcccagggctctgatgtgtctctcacagttcctaaaggt
gagaccctggggcttttagattgggagaggagttggggcagagggaacacactgggtggc
aggggtctctga

KEGG   Bos indicus (zebu cattle): 109577078
Entry
109577078         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: BOLA class I histocompatibility antigen, alpha chain BL3-7-like
  KO
K06751  MHC class I antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
biu04145  Phagosome
biu04218  Cellular senescence
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04940  Type I diabetes mellitus
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577078
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109577078
   04145 Phagosome
    109577078
  09143 Cell growth and death
   04218 Cellular senescence
    109577078
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109577078
   04612 Antigen processing and presentation
    109577078
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109577078
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109577078
   05330 Allograft rejection
    109577078
   05332 Graft-versus-host disease
    109577078
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577078
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577078
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577078
   05170 Human immunodeficiency virus 1 infection
    109577078
   05168 Herpes simplex virus 1 infection
    109577078
   05163 Human cytomegalovirus infection
    109577078
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577078
   05169 Epstein-Barr virus infection
    109577078
   05165 Human papillomavirus infection
    109577078
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577078
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109577078
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109577078
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Antigens
  109577078
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 stn_TNFRSF12A TMEM100 PTP_tm DUF4405 Psg1 FeoB_associated EphA2_TM
Other DBs
NCBI-GeneID: 109577078
NCBI-ProteinID: XP_019841388
Position
23
AA seq 376 aa
MRVMGSRTLVLLLPGALVLTETWAGSHSLRYFYTAVSRPGLEEPRFIIVGYVDDMQFVRF
DSDAPDPRMEPRARWVEQERPEYWDQATQRTKDTKQTFRANLNNLRGYYNQSEAGSHTLQ
EMYGCDVGSDGGFLRXYDQFAYDGRDYIALNEDLRSWTAADPAAQXSKRKIEQSGAAKGE
RNYLNRECVEGLRRYLETGKDTLLRTDPPKTHVTCHPISGREVTLRCWALGFYPEEILLT
WQRDGEDQTQDMELVETRPSGDGTFQKWAALVVPSGEEQRHTCRVQHEGLQEPRTLRWEP
PETSFLTMGIIVGLVLLVVAVVAVVTGAVIWRKKRSGERGHYTQAESKCRGDTIPGTLLR
VQTRGHGGSSSSKCLL
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgcgggtcatggggtcgagaaccctcgtcctgctgctgccgggtgcgctggtcctgacc
gagacctgggcgggctcccactccctgaggtatttctacaccgccgtgtcccgacccggc
ctcgaggagccccgctttatcatcgtcggctacgtggacgacatgcagttcgtgcggttc
gacagcgacgccccggatccgaggatggagccgcgggcacggtgggtggagcaggagcgg
ccggagtattgggatcaggcgacgcagagaactaaggacaccaaacagactttccgagcg
aacctgaacaacctgcgcggctactacaaccagagcgaggccgggtctcacaccctccag
gagatgtacggctgcgacgtggggtcggacgggggtttcctgcgcnggtatgatcagttc
gcctacgatggcagagattacatcgctctgaacgaggacctgcgctcctggaccgcggcg
gacccggcggctcagrtctccaaacgcaagattgagcagagtggtgctgcgaagggcgag
aggaactacctgaaccgcgagtgcgtggaggggctccgcagatacctagagaccggaaag
gacacgctgctgcgcacagaccctccaaagacacatgtgacctgtcaccccatctctggc
cgtgaggtcaccctgaggtgctgggccctgggcttctaccctgaggagatcttactgacc
tggcagcgtgacggggaggaccagacccaggacatggagcttgtggagaccaggccttca
ggggatggaaccttccagaagtgggcggccctggtggtgccttctggagaggagcagaga
cacacatgccgtgtgcagcatgagggacttcaggagccccgcaccctgagatgggaacct
cctgagacctccttcctcaccatgggcatcattgttggcctggttctccttgtggtagct
gtggtggctgtggtgactggagctgtgatttggaggaagaagcgctcaggtgaaagaggg
cactacactcaggctgaaagtaagtgcagaggggatacgatacctgggacccttctgagg
gtgcagacaagaggtcatgggggctcatcctcctcaaagtgccttctctag

KEGG   Bos indicus (zebu cattle): 109577080
Entry
109577080         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: BOLA class I histocompatibility antigen, alpha chain BL3-6-like
  KO
K06751  MHC class I antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
biu04145  Phagosome
biu04218  Cellular senescence
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04940  Type I diabetes mellitus
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577080
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109577080
   04145 Phagosome
    109577080
  09143 Cell growth and death
   04218 Cellular senescence
    109577080
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109577080
   04612 Antigen processing and presentation
    109577080
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109577080
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109577080
   05330 Allograft rejection
    109577080
   05332 Graft-versus-host disease
    109577080
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577080
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577080
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577080
   05170 Human immunodeficiency virus 1 infection
    109577080
   05168 Herpes simplex virus 1 infection
    109577080
   05163 Human cytomegalovirus infection
    109577080
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577080
   05169 Epstein-Barr virus infection
    109577080
   05165 Human papillomavirus infection
    109577080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577080
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109577080
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109577080
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Antigens
  109577080
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 109577080
NCBI-ProteinID: XP_019841390
Position
23
AA seq 360 aa
MGPRTLLLLLSEVLVLTETWAGSHSLSYFCTCVSRPGLGEPRFFAVGYVDDTQFARFDSD
APNPRMEPRAPWMEQEGPEYWEAMTRDAKKAQQRLRTGLNTJRGFYNQSEAGSHTLQWVX
GCDVGPEGRLLRGIWQNAYDGADYLALNEDLRSWTAANTVAQITKRKWETSGEAEFQRNY
LEVKCVQWLLRHLETGKDTLLRADPPKXHVAHHPISDREVTLRCWALGFYPEEISLTWQH
DGEDQTQDMELVETRPSGDGTFQKWAALVVPSGEEQRYTCHVQHEGLQEPLSLRWKPPQP
SIPIMGIIVGLVLLMVTGAXVTGAVIWRKKHSGQTGRGYTQAASSDXAQGSDVSLMVPKV
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggggccgcgaaccctcctcctgctgctctcggaggtcctggtcctgaccgagacctgg
gcgggctcccactccctgagctatttctgcacgtgcgtgtcccggcccggcctcggggag
ccgcgtttctttgccgtcggctacgtggacgacacacagttcgcgcggttcgacagcgac
gccccgaatccgagaatggagccgcgggcgccttggatggagcaggaggggccggaatat
tgggaagcgatgacaagagatgccaagaaagctcaacagagattgcgaacgggcttgaac
accwtacgcggtttctacaaycagagcgaggccgggtctcacaccctccagtgggtgytt
ggctgcgacgtggggccggaggggcgcctcctccgcgggatctggcagaacgcctatgac
ggtgcggattacctcgccctgaacgaagacctgcgctcctggaccgcggcgaacacggtg
gctcagatcaccaagcgcaagtgggaaacctccggggaggcagagttccaacggaactac
ctggaggtcaagtgcgtgcagtggctcctcagacacctggagacaggaaaggacacgttg
ctgcgcgcagaccctccaaagrcacatgtggcccatcaccccatctctgaccgtgaggtc
accctgaggtgctgggccctgggcttctaccctgaggagatctcactgacctggcagcat
gacggggaggaccagactcaggacatggagcttgtggagaccaggccttcaggggatgga
accttccagaagtgggcggccctggtggtgccttctggagaagagcagagatacacgtgc
cacgtgcagcacgaggggcttcaggagcccctctccctgagatggaaacctcctcagccc
tccatccccatcatgggcatcattgttggcctggttctcctcatggtcactggagctrtg
gtgactggagctgtgatttggaggaagaagcactcaggtcaaacaggaaggggctacacc
caggctgcaagcagtgacagkgcccagggctctgatgtgtctctcatggttcctaaagtg
tga

KEGG   Bos indicus (zebu cattle): 109577083
Entry
109577083         CDS       T04792                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7-like isoform X1
  KO
K06751  MHC class I antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
biu04145  Phagosome
biu04218  Cellular senescence
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04940  Type I diabetes mellitus
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577083
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109577083
   04145 Phagosome
    109577083
  09143 Cell growth and death
   04218 Cellular senescence
    109577083
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109577083
   04612 Antigen processing and presentation
    109577083
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109577083
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109577083
   05330 Allograft rejection
    109577083
   05332 Graft-versus-host disease
    109577083
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577083
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577083
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577083
   05170 Human immunodeficiency virus 1 infection
    109577083
   05168 Herpes simplex virus 1 infection
    109577083
   05163 Human cytomegalovirus infection
    109577083
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577083
   05169 Epstein-Barr virus infection
    109577083
   05165 Human papillomavirus infection
    109577083
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577083
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109577083
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109577083
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Antigens
  109577083
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 109577083
NCBI-ProteinID: XP_019841392
Position
23
AA seq 353 aa
MLWGPVLLYFFLAYLPETQTRSHSLQYFYSVVSEPGPGVPSFMAFGFVDNQPFIRYDSEE
MKAKSCVHWLREEPSYFDDETKIFTSRMKIFHLNLRNVQQYYNQTKEDGLNRXLAQKQTS
PHTLQFTYGCELLEDGRTTWHWQYGYDGEDYLSLHMDPLQYTAATFVAQYTKQKWEAGGN
FIERDKNYLEKECILWLWRYLTFGGESLNRTEPPKTHMTHHRISDREVTLRCWALGFYPA
KISLTWQRNGEDQTQDMELVETRPSGDGTFQKWAALVVPSGEEQKYTCXVQHEGLQEPLT
LRWEPLKTSVPITGIIVVLVLLVVTRAVIWIKKLSGYYHSTNGKNRTYFQTAI
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgctgtggggccctgtcctcttgtatttcttcctagcatacctgccagagacacaaacc
cgatcacactctctgcagtatttctactcagttgtgtctgaaccgggtccaggagtccct
tcatttatggcttttggcttcgtggacaaccagcccttcattcgctatgacagtgaagag
atgaaggcaaagtcttgtgttcattggttgagggaggagccaagttactttgatgatgag
accaagatcttcacaagtcggatgaagattttccacttaaatctgaggaatgtacagcaa
tattacaaccaaaccaaggaggatggtctgaacagagygctggcacaaaagcaaacaagc
ccccacaccctccagttcacctacggctgtgagctcctggaggacggcaggaccacgtgg
cactggcagtatggctatgatggtgaggactacctgagcttgcatatggaccctctgcaa
tacacagcagccacattcgttgctcagtacaccaaacaaaartgggaggccggtgggaac
ttcatagagagagacaagaactacttggagaaggaatgcatcctgtggttgtggagatac
ttgacgtttggaggggagagcttgaaccgcactgagcctcccaaaacacacatgactcat
caccgcatctctgaccgtgaggtcaccctgaggtgctgggccctgggcttctaccctgcg
aagatctcactgacctggcagcgcaatggggaggaccagacccaggacatggagcttgtg
gagaccagaccttcaggagacggaaccttccagaagtgggcggccctggtggtgccttct
ggagaggagcagaaatacacrtgccrtgtgcagcacgaggggcttcaggagcccctcacc
ctgagatgggaacctctgaagacctccgtccccatcacaggcatcattgttgtcctggtt
ctcctcgtggtcactagagctgtgatctggataaagaagctctcaggatattatcactct
acaaatggaaaaaatagaacctactttcagactgcaatctaa

KEGG   Bos indicus (zebu cattle): 109577088
Entry
109577088         CDS       T04792                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7 isoform X1
  KO
K06751  MHC class I antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
biu04145  Phagosome
biu04218  Cellular senescence
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04940  Type I diabetes mellitus
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577088
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109577088
   04145 Phagosome
    109577088
  09143 Cell growth and death
   04218 Cellular senescence
    109577088
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109577088
   04612 Antigen processing and presentation
    109577088
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109577088
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109577088
   05330 Allograft rejection
    109577088
   05332 Graft-versus-host disease
    109577088
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577088
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577088
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577088
   05170 Human immunodeficiency virus 1 infection
    109577088
   05168 Herpes simplex virus 1 infection
    109577088
   05163 Human cytomegalovirus infection
    109577088
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577088
   05169 Epstein-Barr virus infection
    109577088
   05165 Human papillomavirus infection
    109577088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577088
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109577088
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109577088
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Antigens
  109577088
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 ig Ig_2 EphA2_TM FeoB_associated
Other DBs
NCBI-GeneID: 109577088
NCBI-ProteinID: XP_019841405
Position
23
AA seq 286 aa
MEQEGPEYWDRETRNLKXAAQTFRVNLNTLLGYYNQSEAGSHTLQWMYGCVXXPDGRFLR
GYRQDAYDGRDYIALNEDLRSWTAADTAAQITKRKWEAAGEAERQRNYLEGRCVEXLRRY
LENGKDTLLRADPPKAHVTRHPSSDREVTLRCWALGFYPEEISLTWQHNGEDQTQDMELV
ETRPSGDGTFQKWAALVVPSGEEQRYTCRVQHEGLXXPLTLRWEPPQTSFLTMGIIVGLV
LLVVAVVAGAVIWRKKXSGEKGRIYTQAASSDSAQGSDVSLTVPKV
NT seq 861 nt   +upstreamnt  +downstreamnt
atggagcaggaggggccggagtattgggatcgggagacgcgaaacttaaaggrcgccgca
cagactttccgagtgaacctgaacaccctrctcggctactacaaccagagcgaggccggg
tctcacaccctccagtggatgtacggctgcgttgnnnggccggacgggcgtttcctccgc
gggtacaggcaggacgcctacgacggcagagattacatcgccctgaacgaggacctgcgc
tcctggaccgcggcggacacggcggctcagatcaccaagcgcaagtgggaggcggcaggt
gaggcggagagacagaggaactacctggagggccggtgcgtggagkggctccgcagatac
ctggagaacgggaaggacacgctgctgcgcgcagaccctccaaaggcacatgtgacccga
caccccagctctgaccgtgaggtcaccctgaggtgctgggccctgggcttctaccctgag
gagatctcactgacctggcagcacaatggagaggaccagacccaggacatggagcttgtg
gagaccaggccttcaggggatggaaccttccagaagtgggcagccctggtggtgccttct
ggagaggagcagagatacacgtgccgtgtgcagcatgaggggcttnnnnagcccctcacc
ctgagatgggaacctcctcagacctccttcctcaccatgggcatcattgttggcctggtt
ctcctcgtagtagctgtggtggctggagctgtgatctggaggaagaagcrctcaggtgaa
aaaggacggatctacacccaggctgcaagcagtgacagtgcccagggctctgatgtgtct
ctcacggttcctaaagtttga

KEGG   Bos indicus (zebu cattle): 109577113
Entry
109577113         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: BOLA class I histocompatibility antigen, alpha chain BL3-7-like
  KO
K06751  MHC class I antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
biu04145  Phagosome
biu04218  Cellular senescence
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04940  Type I diabetes mellitus
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577113
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109577113
   04145 Phagosome
    109577113
  09143 Cell growth and death
   04218 Cellular senescence
    109577113
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109577113
   04612 Antigen processing and presentation
    109577113
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109577113
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109577113
   05330 Allograft rejection
    109577113
   05332 Graft-versus-host disease
    109577113
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577113
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577113
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577113
   05170 Human immunodeficiency virus 1 infection
    109577113
   05168 Herpes simplex virus 1 infection
    109577113
   05163 Human cytomegalovirus infection
    109577113
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577113
   05169 Epstein-Barr virus infection
    109577113
   05165 Human papillomavirus infection
    109577113
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577113
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109577113
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109577113
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Antigens
  109577113
SSDB
Motif
Pfam: MHC_I C1-set Ig_2 ig MHC_I_C C2-set_2 MATalpha_HMGbox
Other DBs
NCBI-GeneID: 109577113
NCBI-ProteinID: XP_019841436
Position
23
AA seq 454 aa
MGPRTLLLLLSGVLVLTETWVQTGLCAEGRGDCPGLGAGVVAGAGSPEKETRRSPRPDPS
SPTWSRPVPPLLPAPLSLPQQVPVLLRPFRSHGPLGPSPLPAPSPLTRDPLQEEHRAGSH
PSPPPGSHSLSYFCTCVSRPGLGEPRFFAVGYVDRTQFARFDSDAPNPRMEPRAPWMEQE
GPEYWEEMTRDAKKAQQRMRLALNNLRGYYNQSEAGSHTLQFVFGCHVGLDGRLLRGIWR
TAYDGADYLXLNEDLRSWTAANTVAQITKRKWETSGEAEFQRNYLEVKCVQWLLRHLEKG
KDTLLRADPPKTNVAHHRISDHDITLRCWALGFYPEEISLTWQRDREDQTQDMEFVETRP
SGDGTFQKWVALVVPSGEEQRYTCCVQHEGLQKPLTLRWEPPQPSIPIMGIIVTVLLMVT
GAVVTEAVIWRKKHSGEVGRGYTQAASKYGGDDS
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggggccgcgaaccctcctcctgctgctctcgggggttctggtactgaccgagacctgg
gtacagaccggcctctgcgcggagggccgaggggactgcccaggactcggggcgggggta
gtggcgggggcaggatccccagagaaggagacacgccgcagccctcgcccagacccgtcc
tctcccacctggtcccgtcccgtccctcccctgctycccgcccctctttctctcccccaa
caagtcccggtccttctccgaccttttcggtctcacgggcccctaggcccctccccactc
ccggctccatcacctctgacccgggacccgctccaggaggaacatcgggccgggtctcac
ccctccccgcccccaggctcccactccctgagctatttctgcacctgcgtgtcccggccc
ggcctcggggagccgcgtttctttgccgtcggctacgtggaccgcacacagttcgcgcgg
ttcgacagcgacgccccgaatccgagaatggagccgcgggcgccttggatggagcaggag
gggccggagtattgggaagagatgacacgagatgccaagaaagctcaacagagaatgcgr
ttagccttgaacaacctgcgcggctactacaaccagagcgaggccgggtctcacaccctc
cagtttgtgtttggctgccacgtggggctggacgggcgcctcctccgcgggatctggcgg
accgcctatgacggtgcggattacctcngcctgaacgaagacctgcgctcctggaccgcg
gcgaacacggtggctcagatcaccaagcgcaagtgggaaacctccggggaggcagagttc
caacggaactacctggaggtcaagtgcgtgcagtggctcctcagacacctggagaagggg
aaagacacgctgctgcgcgcagaccctccaaagacaaacgtggcccatcaccgcatctct
gaccatgacatcaccctgaggtgctgggccctgggcttctaccctgaggagatctcactg
acctggcagcgtgacagggaggaccagactcaggatatggagtttgtggagaccaggcct
tcaggggatggaaccttccagaagtgggtggccctggtggtgccttctggagaggagcag
agatacacgtgctgtgtgcagcatgaggggctacagaaacccctcaccctgagatgggaa
cctcctcagccctccattcccataatgggcatcattgttacggttctcctcatggtcact
ggagctgtggtgactgaagctgtgatttggaggaagaagcactcaggtgaagtaggaagg
ggctacactcaggctgcaagtaagtatggaggggatgattcctga

DBGET integrated database retrieval system