KEGG   Bos indicus (zebu cattle): 109562148
Entry
109562148         CDS       T04792                                 

Gene name
NCAM2
Definition
(RefSeq) neural cell adhesion molecule 2
  KO
K06491  neural cell adhesion molecule
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu05020  Prion disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109562148 (NCAM2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    109562148 (NCAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109562148 (NCAM2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109562148 (NCAM2)
   04090 CD molecules [BR:biu04090]
    109562148 (NCAM2)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109562148 (NCAM2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109562148 (NCAM2)
Membrane trafficking [BR:biu04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    109562148 (NCAM2)
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  NCAM1/2
   109562148 (NCAM2)
CD molecules [BR:biu04090]
 Proteins
  109562148 (NCAM2)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Adhesion molecules of cell surface
   109562148 (NCAM2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Others
  109562148 (NCAM2)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_C17orf99 Ig_4 Ig_5 Pur_ac_phosph_N Adeno_E3_CR1
Other DBs
NCBI-GeneID: 109562148
NCBI-ProteinID: XP_019820697
Position
1
AA seq 728 aa
MKPKKLTFREVVSPQEFKQGENAEVVCRVSSSPAPVVSWLYHNEEVTAISDSRFAMLANN
NLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPLITMPQKSFNATAERGEEMT
FSCRASGSPEPTISWYRNGKFIEENEKYSLRGSNTELTVRNIINSDGGPYVCKATNKAGE
DEKQVLLQVFVQPHIIQLKNETTYENGQVTLICEAEGEPIPAITWKRAVDGITFSEGDKS
PDGRIEVKGQHGSSSLHIKDVDLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTI
YYSWEGNPINISCDVKSNPPASVHWRREKLVLPAKNTTNLKTYSTGRKIILEIAPTSDND
FGRYNCTATNRIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFSKPDSHGGVPINH
YQVDVKEVASETWKIVRSHGVQTMVVLSNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTL
PVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKD
HIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAVIGLGV
AALLLILVVTDVSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPI
VEMRTEDERITNHEDGSPVNEPNETTPLTEPEKLPLKEENGKEVLNPETIEIKVSNDIIQ
SKEDDSKA
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgaaaccaaaaaaactcactttcagagaagtggtatctcctcaagagttcaaacaagga
gagaatgcagaagtggtttgccgagtcagcagctcacccgcacctgtcgtcagctggtta
tatcataatgaggaagtcaccgctatatccgacagtcggttcgctatgttagccaacaat
aatctgcagattctcaacatcaataaaagtgatgaaggtatatacaggtgtgaaggaaga
gtggaggctaggggagaaattgacttccgtgatatcattgttattgttaatgtaccaccg
ctgatcacaatgcctcagaaatcctttaacgccacagcagagagaggagaagagatgaca
ttttcctgcagggcctcaggctctcctgagcccaccatctcctggtacaggaatggcaag
ttcattgaagaaaatgaaaagtactcattgagaggaagcaatacagaactcactgtcagg
aacataatcaatagtgatgggggcccttatgtctgcaaggccacaaataaggcaggagaa
gatgaaaaacaggtgcttctccaagtctttgtacagcctcacataatacagcttaaaaat
gagactacatatgagaatggtcaagtcacactcatatgtgaagcagaaggggagcctatt
ccagcaatcacctggaagagagcagtggatggcatcactttttctgaaggtgataagagc
ccagacggacgtatcgaagtcaaagggcagcatggaagctcatcactgcacattaaagat
gtggacttgtcagattcagggagatacgactgtgaagctgcaagtagaattggagggcac
caaaagagcatgtaccttgatattgaatatgctcccaagttcatatcaaatcaaacaatt
tattactcttgggaaggaaatccaatcaatataagctgtgatgtgaaatcaaatccacca
gcatcagtccattggagaagagagaaattagtcttgccagctaaaaacaccactaattta
aagacatatagcacagggagaaaaataatattagagattgcacctacatccgataatgac
tttggacgatataattgcacagctactaatcgtataggaacaagatttcaagagtatatt
cttgctttggctgatgttccatcaagtccctatggagtgaagattatagagctgtcacag
accacagccaaggtttctttcagcaagccggactcccatggaggcgtgcctattaatcac
tatcaagtggatgtcaaagaagtggcatcagaaacctggaaaatagtacgctcccatgga
gttcaaacaatggttgttttgagcaacctggaaccaaatacaacttatgaaatcagggtt
gcagctgtaaatggaaaaggacaaggagactatagtaaaatagaaattttccaaacacta
ccagtccgtgaaccgagtcctccatccatacatggacagccaagcagtgggaagagcttt
aagctgagtatcaccaaacaggatgatggtggagcccctattttagaatacatcgtgaaa
tatagaagtaaagataaagaagatcagtggctagagaaaaaagtgcagggaaataaagac
cacattattttggagcatctacagtggacaatgggatatgaagttcaaattacagctgcc
aatagattgggatattcagaaccaacagtctatgaattcagcatgccgcctaagcccaac
attattaaagacacactttttaatggtcttgggcttggagcggtcattggtctgggagtc
gccgcactcttgctaatcctggtggtaacagatgtcagctgcttctttattcgacagtgt
gggttattgatgtgcatcaccaggagaatgtgtgggaagaaaagtggctccagtggtaaa
agtaaagaacttgaagaaggaaaagctgcatacctgaaagatggatcaaaagaaccaata
gtggagatgagaacagaggatgaaagaattactaatcatgaagatgggagcccagtaaat
gagccaaatgaaaccacaccactaacagaacctgaaaaattgcctttaaaagaagaaaat
gggaaagaagtcctaaatccagaaacgatagaaattaaggtttctaacgacatcattcaa
tcaaaagaagatgacagcaaagcataa

KEGG   Bos indicus (zebu cattle): 109569890
Entry
109569890         CDS       T04792                                 

Gene name
NCAM1
Definition
(RefSeq) neural cell adhesion molecule 1 isoform X1
  KO
K06491  neural cell adhesion molecule
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu05020  Prion disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109569890 (NCAM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    109569890 (NCAM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109569890 (NCAM1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109569890 (NCAM1)
   04090 CD molecules [BR:biu04090]
    109569890 (NCAM1)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109569890 (NCAM1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109569890 (NCAM1)
Membrane trafficking [BR:biu04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    109569890 (NCAM1)
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  NCAM1/2
   109569890 (NCAM1)
CD molecules [BR:biu04090]
 Proteins
  109569890 (NCAM1)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Adhesion molecules of cell surface
   109569890 (NCAM1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Others
  109569890 (NCAM1)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set C2-set_2 fn3 Ig_5 Ig_4 C1-set Ig_6 Ig_C17orf99 Adeno_E3_CR1 Collagen_bind_2 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 109569890
NCBI-ProteinID: XP_019831223
Position
15
AA seq 628 aa
MLQTKNLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE
KLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTAEDGTESEATVNVKIFQKLMF
KNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLTNNYLQIRGIK
KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCNAEGF
PEPTVSWTKDGEQIENEEDEKYLFSDDSSELTIRKVDKNDEAEYVCIAENKAGEQDASIH
LKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEK
QETLDGHMVVRSHARVSSLTLKSIQYTDAGEYVCTASNTIGQDSQSMYLEVQYAPKLQGP
VAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSE
NDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPIL
KYKAEWRAMGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAAS
EFKTQPVRKYSPLPSSSPWGGGTHPVFR
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgctgcaaactaagaatctcatctggactttgtttttcctgggaactgcagtttctctg
caagtggatattgttcccagccaaggggaaatcagcgtgggagagtccaaattcttcctg
tgccaagtggccggagatgccaaagataaagacatctcctggttctcgcccaacggagag
aagctcaccccaaaccagcagcggatctcggtggtatggaacgatgactcctcctccacc
ctcaccatctacaacgccaacatcgatgatgccggcatctacaagtgtgtggtcactgcg
gaggatggcacygagtcagaggccacggtcaacgtgaagatcttccagaagctcatgttc
aagaacgcgccaaccccacaggagttcagggagggagaagatgccgtgatcgtgtgtgat
gtggtcagctccctccccccaaccatcatctggaagcacaaaggccgagatgtcatcctg
aaaaaagatgtccgattcatagtcctgaccaacaactacctccagatccggggcatcaag
aaaacagatgagggcacttaccgctgtgagggcaggatcctggcccgcggggagatcaac
ttcaaggacattcaggtcatcgtgaatgtgccacccaccgtccaggccagacagagcatc
gtgaatgccaccgccaacctcggccagtccgtcaccctcgtgtgcaacgccgaaggcttc
ccagagcccaccgtgagctggacgaaggacggggagcagatagagaatgaggaggacgag
aagtacctgttcagcgacgacagctccgagctgaccatcaggaaggtggacaagaacgac
gaggctgagtacgtctgcattgccgagaacaaggcgggcgagcaggacgcgtccatccac
ctcaaggtcttcgcaaaacccaaaatcacctacgtagagaaccagactgccatggaactg
gaggaacaggtcactcttacctgtgaagcctcgggagaccccattccctcaatcacctgg
agaacatccacccgaaacatcagcagtgaagaaaaggcttcgtggactcgaccagagaag
caagagaccctggacgggcacatggtggtgcgcagccacgcccgcgtgtcgtccctgacg
ctgaagagcatccagtacaccgacgccggggagtatgtctgcactgccagcaacaccatc
ggccaggactcccagtccatgtacctcgaagtgcaatatgcccccaagctgcagggccct
gtggctgtgtacacttgggaggggaaccaggtgaacatcacctgcgaggtgtttgcctac
cccagtgccactatctcgtggttccgagacggtcagctgctgcccagctccaactacagc
aacatcaagatctacaacaccccgtccgccagctacctggaggtgaccccagactctgaa
aatgattttggaaactacaactgtaccgcagtgaaccgcatcggacaggagtctttggaa
ttcatccttgtccaagcagatactccatcctcaccatccatcgaccaggtggagccatac
tctagcacagcacaggtgcaatttgatgagccagaggccacaggcggagtgcccatcctc
aaatacaaagctgagtggagagcaatgggcgaggaggtgtggcactccaagtggtatgat
gccaaggaagccagcatggagggcatygtcaccatcgtgggcctcaagcccgagacgacg
tacgcagtccggctggcggccctcaacggcaagggcctgggcgagatcagcgccgcctct
gagttcaagacgcagccagtccgtaagtacagcccgctgcccagctcrtctccctggggt
ggggggacccatccagtgttcagatga

DBGET integrated database retrieval system