KEGG   Bos indicus (zebu cattle): 109562239Help
Entry
109562239         CDS       T04792                                 

Gene name
MRPL22
Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial isoform X1
  KO
K02890  large subunit ribosomal protein L22
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    109562239 (MRPL22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:biu03011]
    109562239 (MRPL22)
Ribosome [BR:biu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    109562239 (MRPL22)
  Bacteria
    109562239 (MRPL22)
  Archaea
    109562239 (MRPL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 109562239
NCBI-ProteinID: XP_019820853
Position
7
AA seq 210 aa AA seqDB search
MAAVILERLGALWVQNLRGKLALGLFSSHSILPQSHIHTSASLEISRKWEKKNKIVYPPQ
LPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFSDKKGAQIIKEVLL
EAQDMAVRDHNVEXRSNLYIAESTSGRGQYLKRIRYHXRGRFGIMEKVFCHYFVKLVEGP
PPPPEAPKTAVTHAKEYIQELRNRTIIHXL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggttatactggaacgtttgggtgcgttatgggtgcagaatctcagggggaag
ctggccttggggcttttttcatctcacagcattttacctcaatcacatatccacacaagt
gcttctcttgaaatatctcgaaaatgggagaagaagaataaaattgtttatcctccacaa
ctgcctggagaacctcggagaccagctgaaatctaccattgtcgaagacaaataaagtac
agcaaagacaagatgtggtatttggcgaaattgatacgaggaatgtcaattgaccaggct
ctggctcaactggaattcagtgacaaaaaaggagcccagataattaaagaggttctctta
gaagcacaagatatggcagtaagagaccacaatgtggaattmagatccaatttatatata
gctgagtccacctcagggcgaggccaatacctgaaacgcatccgataccacrgcagaggt
cgctttgggattatggagaaggttttttgccattattttgtgaagttggtggaaggccct
ccacctccacctgaggcaccaaagacagcagtcacccacgctaaagagtatatccaggag
cttcgcaaccggaccatcattcacrctctgtga

DBGET integrated database retrieval system