KEGG   Bos indicus (zebu cattle): 109562343
Entry
109562343         CDS       T04792                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
biu  Bos indicus (zebu cattle)
Brite
KEGG Orthology (KO) [BR:biu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109562343 (ERAP1)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109562343 (ERAP1)
Peptidases and inhibitors [BR:biu01002]
 Metallo peptidases
  Family M1
   109562343 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 109562343
NCBI-ProteinID: XP_019820998
Position
7
AA seq 942 aa
MISPSIKWSLXTRPLLLSTLLILLTVATPSSCQSREPTSPKASNGAPFPWNKIRLPEHII
PAHYDLMIHANLTTLTFGGTTQIEITASKPTSTIILHSHRLQISKAALRKGGGERQAEEP
LRVLENPPQEQIALLASEPLVVGLPYTIVIDYAGNLSESFHGFYKSTYRTKEGEVRILAS
TQFEPTAARMAFPCFDEPAFKASFLIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVT
VRMSTYLVAFIVSDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFQSGAMENWGLTTYRESSLLFDAEKSSASSKLGITMIVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFNAMEVDALNSSHPV
STPVENPAQIREMFDEVSYDKGACILNMLRDYLGADAFKSGIVKYLQKYSYKNTKNEDLW
NSMASICPTDDTQRMDGFCSRGEHASSTAHWRQEGLDVKTMMNTWTLQKGFPLITITVRG
RNVHMKQEYYVKGAADAPETGFLWHVPLTFITSKSDAVQRFLLKTRTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKGTHTAISSNDRASLINNAFQLVSIGKLSIEKALD
LTLYLKHETEIMPVFQGLNELIPMYKLMEKREMNEVETQFKAFLIRLLRDLIDKXTWTDE
GSVSERMLRSQLLFLACVRKYQPCVQKAEGYFRQWQEAGGNLSLPNDVTLAVFAVGAQTL
EGWDFLYSKYQSSLSSTEKNQIEFALCISQNKEKLQWLLDQSFKGDVIKTQEFPDILRAI
GRNPVGYPLAWQFLRENWNKLVQKFELGSNSIAYMVTGTTDQFSTRARLEEVKEFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIRAWLQNEKLNLL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgatatctccatccatcaaatggtcacttrgaaccaggcccttactgctttcgacactg
ctgattctcttaacggtggcaactccatcctcatgtcagagcagggaaccaacatctcca
aaagctagcaacggggcaccatttccttggaataaaattmgacttccagagcacatcatc
ccagctcattacgatctcatgattcacgcaaacctcaccactctgactttcgggggaacc
acacagatagaaatcacagccagcaagcccaccagtaccatcatcctgcacagtcaccgc
ctacaaatatccaaggccgccctgaggaagggaggtggcgagaggcaggctgaagagcca
ctgagagtcctggaaaacccacctcaggagcagattgcgcttctggcttctgagccgctg
gtcgtcggcctcccatacaccattgtcatcgactacgctggcaatctttctgagagtttc
catggattttataaaagtacctacagaaccaaggaaggagaagtgaggatacttgcatcr
acacagttcgaaccaactgcagccagaatggcctttccctgctttgatgaacctgctttc
aaggcgagttttttaatcaagatcagaagggaaccaagacacctcgccatctccaatatg
ccactggttaaatctgtgactgtggctgaaggactcatagaagaccactttgacgtcacc
gtgaggatgagcacctacctggtggccttcattgtttcggatttcaagtctgtcagcaag
atgaccaagagcggagtcaaggtttccgtatatgctgttccagacaagataaatcaggca
gaytatgcactggatgccgcggtgactcttctagaattttatgaggattatttcagcatc
ccrtatccgttacccaaacaagatcttgctgcaattcccgacttccartctggtgcaatg
gaaaactggggactgacgacatacagggaatcttctctactgtttgatgctgagaagtct
tcygcctcaagtaagctcggcatcacgatgattgtgtctcatgaactcgcccaccagtgg
tttgggaacctygtcactatggaatggtggaatgatctttggctaaatgagggatttgcc
aagtttatggagttcgtgtcagtcagtgtgactcatccagaactgaaagttgaagattat
ttctttggtaagtgtttcaacgcaatggaggtggatgcattaaactcctcacaccccgtg
tccacacccgtggagaaccctgctcagattcgcgagatgtttgatgaagtttcttatgac
aagggagcttgtattctgaatatgctaagggactatcttggtgccgatgcatttaaaagt
ggcattgtaaagtatctgcagaagtatagctataaaaacacgaaaaacgaggacctgtgg
aatagtatggcaagcatytgccctacagatgacacacaacgcatggatggattttgttct
agaggtgaacatgcatcttcaaccgcgcactggcgacaggaaggccttgatgtgaaaacc
atgatgaacacctggacgctgcagaagggtttccccctgataaccatcaccgtgagaggc
aggaacgtacatatgaagcaagagtactatgtgaaaggcgcggccgatgccccagaaact
gggttcctgtggcatgtcccactgacattcattaccagcaaatcagacgcagtccaacgc
tttttgctgaagacaagaacagatgtgctcatcctcccagaagaggtggaatggatcaaa
tttaatgtcggaatgaatggctattacattgtgcattatgaggatgatggatgggactct
ctgactggccttttaaaaggaacacacacggcaatcagcagtaacgatcgggccagtctc
attaacaatgcatttcagcttgtcagcattggaaagctgtcaattgaaaaagccttggat
ttaaccttgtacctgaagcatgaaactgaaatcatgccagtgtttcaaggtttgaatgag
ctgataccgatgtataagttaatggagaagagagagatgaatgaagtggaaactcaattc
aaggcctttctcatcaggctgctgagggacctcattgacaagyagacgtggacggatgag
ggctccgtctcggagcgaatgctgcggagtcagctgctcttcctcgcctgygtgcgcaag
taccagccctgcgtgcagaaggcagaaggctatttcagacagtggcaggaagccggtgga
aacctcagcctgcccaacgatgtgaccttggcagtgtttgccgtgggggcccagaccctc
gaaggatgggattttctttatagtaaataccagtcgtcattgtccagtactgagaaaaac
caaattgaatttgctctctgtatcagccaaaataaagaaaagcttcagtggctactagat
caaagttttaagggagatgtaataaaaactcaagagtttccagatattcttagagctatt
ggcagaaacccagtgggatatccgttggcctggcagtttctgagggaaaactggaacaaa
cttgtgcaaaagtttgaacttggctcaaattccatagcctacatggtaacgggaacaaca
gatcagttctcaacaagagcacggctcgaagaggtaaaagaattcttcagctctttgaag
gaaaacgggtctcagctccgttgtgttcaacaaaccatcgaaactatcgaggaaaacata
cgttggatggataagaattttgataagatcagagcgtggctgcaaaatgagaagcttaat
ctgctataa

DBGET integrated database retrieval system