KEGG   Bos indicus (zebu cattle): 109562726
Entry
109562726         CDS       T04792                                 

Definition
(RefSeq) kininogen-1-like
  KO
K03898  kininogen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04022  cGMP-PKG signaling pathway
biu04071  Sphingolipid signaling pathway
biu04080  Neuroactive ligand-receptor interaction
biu04610  Complement and coagulation cascades
biu04750  Inflammatory mediator regulation of TRP channels
biu04810  Regulation of actin cytoskeleton
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    109562726
   04022 cGMP-PKG signaling pathway
    109562726
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109562726
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109562726
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109562726
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109562726
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562726
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562726
   05143 African trypanosomiasis
    109562726
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109562726
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109562726
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I25: cystatin family
   109562726
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   109562726
  Exosomal proteins of other cancer cells
   109562726
SSDB
Motif
Pfam: Cystatin Cathelicidins SQAPI DUF5605 Bradykinin Latexin PMG
Other DBs
NCBI-GeneID: 109562726
NCBI-ProteinID: XP_019821293
Position
1
AA seq 325 aa
MSSQISFLNAAVLPTLCQAEGPVVTAQYECLGCVHPISTKSPDLEPVLRYAIQYFNNNTS
HSHLFDLKEVKRAQRQVVSGWNYEVNYSIAQTNCSKEEFSFLTPDCKSLSIGDTGECTDK
AHVDVKLRISSFSQKCDLYPVKDFVQPPTRLCAGCPKPIPVDSPDLEEXLXHSIAKLNAE
HDGXFYFKIDTVKKATVQVVXGLKYSIVFIARETTCSKGSNEELTKSCEINIHGQILHCD
ANVYVVPWEEKVYPTVNCQPLGQTSLMKRPPGFSPFRSVQVMKTEGSTTTHVKSCEYKGR
PQEAGAEPAXQGEVSLPAESPQLAR
NT seq 978 nt   +upstreamnt  +downstreamnt
atgtcgtctcagatttcgttccttaacgctgccgttttgcctactctttgtcaagccgag
ggccccgtggtgacagcccagtatgagtgccttggctgtgtgcatcccatatctaccaag
agccccgacttggagcctgttctgagatatgccatccaatattttaacaacaacaccagt
cattcccacctctttgatctgaaagaagtaaaaagagcccaaagacaggtggtgtctgga
tggaactatgaagttaattactcaattgcacaaactaattgttccaaggaggaattttca
ttcttaactccagactgcaagtccctttcaattggtgatactggtgaatgtacagataaa
gcacatgtagatgtcaagctaagaatttcttccttctcgcagaaatgtgacctttatcca
gtgaaggattttgtacaaccacccaccaggctttgtgccggctgccccaaacctatacct
gttgacagcccagacctggaggarsctctgarccattccatcgcaaagcttaatgcagag
catgatggarccttctatttcaagattgacactgtgaaaaaagcaacagtacaggtggta
gstggattgaagtattctattgtgttcatagcaagggaaaccacatgttctaagggaagt
aatgaagagctgaccaagagttgtgagatcaatatacatggtcaaattctacactgtgat
gctaatgtctatgtggtgccttgggaggaaaaagtttaccctactgtcaactgtcaacca
cttggacagacctcactcatgaaaaggcctccgggtttttcacctttccgatcagttcaa
gtgatgaaaactgaaggaagcacaactacgcacgtaaagtcctgcgagtacaagggccga
cctcaagaggcaggggcagagccagcamctcagggtgaggtcagtttaccggcagaatct
ccacagttggcacgatag

DBGET integrated database retrieval system