KEGG   Bos indicus (zebu cattle): 109562779
Entry
109562779         CDS       T04792                                 

Gene name
PROS1
Definition
(RefSeq) vitamin K-dependent protein S
  KO
K03908  protein S
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109562779 (PROS1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_G_2 FXa_inhibition EGF_CA Gla cEGF EGF EGF_3 hEGF
Other DBs
NCBI-GeneID: 109562779
NCBI-ProteinID: XP_019821393
Position
1
AA seq 675 aa
MRVLGGRTGTLLACLALVLPVLEANFLSRQHASQVLIRRRRANTLLEETKKGNLERECIE
ELCNKEEAREIFENNPETEYFYPKYLGCLGSFRAGLFTAARLSTNAYPDLRSCVNAISDQ
CNPLPCNEDGFMTCKDGQATFTCICKSGWQGEKCESDINECKDPVNINGGCSQICENTPG
SYHCSCKNGFIMLSNKKDCKDVDECVLKPSICGTAVCKNIPGDFECECAEGYKYNPVSKS
CDDVDECAENLCAQLCVNYPGGYSCYCDGKKGFKLAQDQKSCEAVPVCLPLDLDKNYELL
YLAEQFVGVVLYLKFRLPETTRFSAEFDFRTYDSEGVILYAESSDHSAWFLIALREGKIE
IQFKNEKTTKMTTGGKVINDGLWHMVSVEELEQSISVKIAKEAVMNINKPGSLFKPTNGF
LETKVYFAGVPRKMENALIRPINPRLDGCIRGWNLMNQGTSGVKEIIQEKQNKHCLVNVE
KGSYYPGTGVAQFSINYKNESNPEAWQINVSLNIRPSAGTGVMLALVSDNTVPFALSLVD
SATEKLQDILVSVESMVIARIEAISLCSDQQTFLEIRVNRNNLELSTQLRKDSFHSEDFQ
RQFAILDEAMKGTVVTYLGGLPDVPFSATPVNAFYQGCMEVNINGVQVDLDEAISKHNDI
RAHSCPSVWQKTKHT
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgagggtcctaggtgggcgcacmgggacgctgctggcatgcctcgccctagtgcttccc
gtcttggaggctaactttttgtcgaggcaacatgcttcacaagtcctgattaggagacgc
cgtgcaaatacattgcttgaagaaacgaaaaagggcaatcttgaaagagaatgcattgaa
gaactgtgcaataaagaagaagccagggaaatctttgaaaataacccggaaacggaatat
ttttatccaaaatatttaggttgtcttggctctttcagagctggattattcactgctgct
cgtctgtcaactaatgcttaccctgacctgaggagctgtgtcaatgccatttcggaccag
tgtaatcctctgccatgcaatgaagatggatttatgacctgcaaagatggccaagcgaca
ttcacttgcatttgtaaatcaggttggcaaggagaaaagtgtgaatctgatataaatgaa
tgcaaagatcctgtaaatataaatggaggttgcagccagatttgtgaaaacacacctgga
agttaccactgttcctgtaaaaatggttttattatgctttcaaataaaaaggactgcaaa
gatgtggatgaatgcgttttaaagccaagcatttgtggcacagctgtgtgcaagaacatc
ccaggagactttgaatgtgaatgtgctgaaggctacaaatacaatcccgtatcaaagtct
tgtgacgatgtggatgaatgcgctgagaacttgtgtgctcaactttgtgtcaattaccct
ggaggttactcttgttactgtgacggaaagaaaggattcaaacttgcccaagatcagaag
agttgtgaggctgttccagtgtgccttcctttggaccttgacaaaaattatgaattgctt
tacttggcagagcagtttgtaggggtcgttttgtatttaaaatttcgtttgccagaaacc
accagattttcagctgaatttgatttccggacatatgattcagaaggtgttatcctgtat
gcagaatcttctgatcactcagcttggttcctgattgcgcttcgtgagggaaagattgaa
attcagttcaagaatgaaaagacaaccaaaatgacaactggaggcaaagttattaatgat
ggtttatggcatatggtctctgtggaagaattagaacagagtattagtgtaaaaatagct
aaagaagctgtaatgaatataaataagcctggaagcctttttaagcccaccaatgggttt
ctagaaaccaaagtatactttgcaggagtacctcggaaaatggaaaatgcactcattaga
ccgattaaccctcgtctagatggatgtattcgaggctggaatttgatgaatcaaggaact
tcaggagtaaaggaaatcattcaagaaaaacaaaataagcattgtcttgtcaatgtggag
aagggttcctactatcctggtactggagttgctcagtttagcataaattataagaatgaa
tccaatcctgaggcttggcaaatcaatgtgtccttgaatattcgcccatcagcgggcacc
ggtgttatgttggccttggtttccgataacacagtgccctttgccttgtccttggtggat
tccgccactgaaaagcttcaggatatcctggtatctgttgaaagtatggtaatagctcgg
atagaggccataagtctgtgttccgatcagcaaacctttctggaaatcagagtcaacaga
aacaatttggaactatcgactcaacttagaaaggatagcttccactctgaagactttcaa
agacaatttgccatcttggatgaagcaatgaaaggaacagtggtcacttacctgggtggc
cttccagatgttccattcagtgccacaccagtgaatgccttttatcaaggctgtatggaa
gtgaacattaatggtgtacaggtggatttggatgaagccatttctaaacataatgatatt
agagctcactcgtgtccatcagtttggcagaagacaaagcatacttaa

DBGET integrated database retrieval system