KEGG   Bos indicus (zebu cattle): 109562811
Entry
109562811         CDS       T04792                                 

Definition
(RefSeq) clusterin
  KO
K17252  clusterin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109562811
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:biu03110]
    109562811
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109562811
Chaperones and folding catalysts [BR:biu03110]
 Other chaperones and cochaperones
  Others
   109562811
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   109562811
SSDB
Motif
Pfam: Clusterin
Other DBs
NCBI-GeneID: 109562811
NCBI-ProteinID: XP_019821404
Position
8
AA seq 439 aa
MKTLLLLMGLLLSWESGWAISDKELQEMSTEGSKYVNKEIKNALKEVKQIKTQIEQTNEE
RKLLLSSLEEAKKKKEDALNDTRDSENKLKASQGVCNETMTALWEECKPCLKQTCMKFYA
RVCRSGSGLVGHQLEEFLNQSSPFYFWINGDRIDSLMENDREQSHVMDVMEDSFTRASSI
MDELFQDRFFLRRPQDTQYYSPFSSFPRGSLFFNPKSRFARNVMPFXLLEPFNFHDVFQP
FYDMIHQAQQAMDAHLQRTPYHFPTMEFTENNNRTVCKEIRHNSTGCLRMKDQCEKCQEI
LEVDCSASNPTQTLLRQQLNASLQLAEKFSRLYDQLLQSYQQKMLNTSALLKQLNEQFTW
VSQLANLTQSDDQHYLQVFTVNSHNSDPSIPSGLTKVIVKLFNSFPITVTVPQEVSSPNF
MENVAEKALQQYRRKSQEE
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaagactctactgctgttgatggggctgctgctcagctgggagagtggctgggcaatc
tcrgacaaagagctccaggaaatgtccaccgagggragtaagtacgtgaataaagaaatt
aaaaatgccctcaaggaggtgaaacagataaagacccaaatagaacaaaccaatgaagag
cgcaaattactgctcagctccctagaggaagccaagaagaagaaagaggacgccctgaat
gacaccagggattctgaaaacaagctgaaggcrtcccagggggtgtgcaatgagaccatg
acagccctttgggaggaatgtaagccctgcctcaagcagacctgcatgaagttctacgcg
cgggtgtgcagaagcggatcgggactggttggccaccagcttgaggagttcctaaaccag
agctcccccttctacttctggatcaayggtgaccgcatcgattccctgatggagaatgac
cgggagcagagccacgtgatggacgtcatggaggacagcttcacccgggcgtccagcatc
atggacgagctcttccaggaccggttcttcctccggaggccccaggacactcagtactac
tcccccttcagctcgttcccgagggggtcactcttcttcaatcccaagtcccgctttgcc
cggaacgtgatgcctttccscttgttggaacccttcaacttccacgatgtgtttcagccc
ttctacgacatgatccaccaggcccagcaggccatggacgcccacctgcagaggactccc
taccacttccccacgatggaattcacagaaaacaacaaccgtactgtgtgtaaggagatc
cgccacaactccacgggatgcctgcggatgaaggaccagtgcgagaagtgccaggagatc
ctggaagtggactgttcggccagcaacccgactcagacgctgctgcgccagcagctgaac
gcatccctgcagctggcggagaagttcagcaggctgtacgaccagctgctccagtcctac
cagcagaagatgctcaacacgtcggccctgctcaagcagctgaacgagcagttcacctgg
gtgtcccagctggccaacctcacgcagagcgacgaccagcactacctgcaggtcttcacg
gtgaattcccacaactccgaccccagcatcccgtctggcctcaccaaggtgattgtgaaa
ctcttcaactccttccccatcacagtgacggtcccgcaggaagtctccagtcctaactty
atggagaatgtggcrgagaaagcactgcagcaataccgccggaagagccaggaggagtga

DBGET integrated database retrieval system