KEGG   Bos indicus (zebu cattle): 109562901
Entry
109562901         CDS       T04792                                 

Gene name
PDCD1LG2
Definition
(RefSeq) programmed cell death 1 ligand 2 isoform X1
  KO
K06708  programmed cell death 1 ligand 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109562901 (PDCD1LG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109562901 (PDCD1LG2)
CD molecules [BR:biu04090]
 Proteins
  109562901 (PDCD1LG2)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set C2-set_2 C1-set
Other DBs
NCBI-GeneID: 109562901
NCBI-ProteinID: XP_019821545
Position
8
AA seq 284 aa
MMRLPQSDPVQSMFLLLILSLGLQLQQTVALFTVTIPKEMYMVDYGSNVTLECDFDTGGP
VELGILKASLQKVENDTVLLSERATLLEEQLPLGKALFLIPRIQLKDAGQYRCLIIYGIA
WDYKYLTLKVKASYKKINTRHLKVPGTDEVELTCQAEGYPLAEVSWPNISIPTNTSHTKT
SEGLYQVTSVLRLKPHPGRNFSCVFWNANVKELTSATIVQGPLEDPKIPSSSLLHVFILS
LIVAPIFIATVVALRKRLCQKLYSGEDSTKRSATMVRREVDRAI
NT seq 855 nt   +upstreamnt  +downstreamnt
atgatgaggctgccacagtcggatccggtacagagcatgttcctcctactaattttgagc
ctgggactgcagcttcaacagacagtagctttgttcacagtgaccatcccaaaggaaatg
tacatggtagactacggcagcaatgtgaccttggagtgtgattttgacactggaggtcct
gtggaactcgggattttaaaagccagtttgcaaaaagtggaaaatgatacagtcttgctc
agtgaaagagccactttgctggaggagcagctgcccctggggaaggccttgttcctcatc
ccccgaatccagctgaaggatgcagggcagtaccgctgcctgatcatctatgggattgcc
tgggactacaagtacctgacgctgaaagtcaaagcttcctataagaaaataaacactcgc
cacctcaaggtcccagggacagatgaggtagagctcacctgccaagctgaaggctatccc
ctggcagaagtgtcttggccaaacatcagtattcctaccaacaccagccacaccaagacc
tctgaaggcctctaccaggttaccagtgttctgcgcctaaagccacaccctggcaggaat
ttcagctgtgtgttctggaatgccaatgtgaaggaactcacttcagccaccattgtccaa
ggtcctctggaagaccccaagatcccttcatcttcactgcttcatgttttcattctctcc
ctcatcgttgctcccatattcatagccacagtggtagccctaagaaaacgactctgccag
aagttgtattctggagaagattcaacaaaaagatctgccaccatggtaaggagagaagtg
gacagagctatttga

DBGET integrated database retrieval system