KEGG   Bos indicus (zebu cattle): 109562902
Entry
109562902         CDS       T04792                                 

Gene name
CD274
Definition
(RefSeq) programmed cell death 1 ligand 1 isoform X1
  KO
K06745  programmed cell death 1 ligand 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109562902 (CD274)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109562902 (CD274)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109562902 (CD274)
CD molecules [BR:biu04090]
 Proteins
  109562902 (CD274)
SSDB
Motif
Pfam: Ig_3 I-set C2-set_2 Ig_2 V-set ig C1-set Ig_6 V-set_CD47 TrmB
Other DBs
NCBI-GeneID: 109562902
NCBI-ProteinID: XP_019821547
Position
8
AA seq 304 aa
MRIYSVLTFMAYCCLLKAFTITVSKDLYVVEYGSNVTLECRFPVDKQLNLLVLVVYWEME
DKKIIQFVNGKEDPNVQHSSYHGRAQLLKDQLFLGKAALQITDVKLQDAGVYCCLISYGG
ADYKRITLKVNAPYRKIYHTISVDPVTSEHELTCQAEGYPEADVIWTSSDHQVLSGKTSI
TSSKREEKLFNVTSTLRINTTADKIFYCTFRRLGHEENNTAELVIPEPYLDPAKKRNHLV
TLGALFLCLSVTLAVIFXLKRDVRMMDVEKCDTRDMNSKQQNGILSLWFGFIRPEVCSGP
GGCR
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaggatatatagtgtcttaacattcatggcttactgttgtttgctgaaagcatttact
atcacagtttccaaggacctgtatgtggtagaatatggcagcaatgtgacgttggaatgc
agatttccagtagacaaacaattaaacctgcttgtgttagttgtttactgggaaatggag
gataagaaaattattcagtttgtgaatgggaaggaagacccaaacgttcagcacagtagc
taccatgggagggcccaactgttgaaggaccagctcttcttgggaaaggctgcacttcag
ataacagatgtgaaattgcaggatgcgggggtttactgttgcttgatcagctatggcggt
gccgactacaagcggattactttgaaagtcaacgctccataccgcaaaatctaccataca
atttctgtggatccagtcacctctgaacatgaactaacgtgtcaggctgagggttaccct
gaagctgatgtcatctggacaagtagcgatcaccaagtcctgagtggcaaaaccagcatc
accagttcaaagagggaggaaaagcttttcaatgtgaccagcacactgagaatcaacaca
acagctgacaaaattttctactgcacttttcggagattaggtcatgaggaaaacaacaca
gctgagttggtcatcccagaaccatatctagatccagcaaaaaagaggaatcacttggtg
actctgggagctctcttcttatgcctgagtgtaaccctggcagtcatcttctrtctgaaa
agagatgtgagaatgatggatgtagaaaaatgtgacacccgagatatgaattcaaagcaa
caaaatgggattctcagcctgtggtttgggtttatcagaccagaggtatgcagtgggcca
gggggctgcagatga

DBGET integrated database retrieval system