KEGG   Bos indicus (zebu cattle): 109563119
Entry
109563119         CDS       T04792                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10B-like isoform X1
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04217  Necroptosis
biu04650  Natural killer cell mediated cytotoxicity
biu05132  Salmonella infection
biu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109563119
   04061 Viral protein interaction with cytokine and cytokine receptor
    109563119
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109563119
   04217 Necroptosis
    109563119
   04115 p53 signaling pathway
    109563119
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109563119
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109563119
  09172 Infectious disease: viral
   05164 Influenza A
    109563119
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109563119
   04090 CD molecules [BR:biu04090]
    109563119
Cytokine receptors [BR:biu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109563119
CD molecules [BR:biu04090]
 Proteins
  109563119
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 109563119
NCBI-ProteinID: XP_019821901
Position
8
AA seq 209 aa
MALEAVTPRQPGQRTLPDRTGQQGQRAAASSSSRAGCTQGPRPPLRGPWALIFTVLGVLL
LVKAASAMSVRKDEIHQQSSAPLERSPQQKLCPPGFYMEEAIRGCAPCTDGIDYTNHSNT
LPSCLLCTTCKSGEEEKNRCTPTKDTECQCKPGTFRGEDAPEFCQKCSTGCPDGKIMVMD
CTPWSNINCVDQESGTPAHGEAPVPGEQP
NT seq 630 nt   +upstreamnt  +downstreamnt
atggctctggaggctgtcaccccgcggcaacctggacagcgaacgctccccgaccgcacc
gggcagcagggacagagagcagcagcctcctcgagctcccgggcaggttgcacccagggc
cccaggcctcccctccggggcccctgggctctcatcttcaccgtcttgggtgtcttgctg
ttggtcaaagctgcttcagccatgtctgtaaggaaggatgaaattcaccagcagtcatca
gccccactggaacggagcccccagcagaagttatgtccaccaggattctatatggaagaa
gccattagaggttgtgccccatgcacagatgggatagactacaccaatcattcaaacacc
ctcccttcttgcttactttgcacgacttgcaaatcaggagaagaagaaaaaaatcgctgc
accccaaccaaggacactgagtgtcagtgcaaacctggcactttccgtggagaagatgca
cctgaattctgtcaaaaatgcagcaccgggtgccctgatgggaagatcatggttatggac
tgtaccccctggagcaacatcaattgtgtggaccaagaatcaggtaccccggcccatggg
gaggctccagttcctggagagcaaccatga

DBGET integrated database retrieval system