KEGG   Bos indicus (zebu cattle): 109563216Help
Entry
109563216         CDS       T04792                                 

Gene name
NTRK2
Definition
(RefSeq) BDNF/NT-3 growth factors receptor isoform X1
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04722  Neurotrophin signaling pathway
biu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109563216 (NTRK2)
   04010 MAPK signaling pathway
    109563216 (NTRK2)
   04151 PI3K-Akt signaling pathway
    109563216 (NTRK2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109563216 (NTRK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    109563216 (NTRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109563216 (NTRK2)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109563216 (NTRK2)
Protein kinases [BR:biu01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   109563216 (NTRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 TPKR_C2 Ig_2 ig LRR_8 LRRNT V-set LRR_5 Haspin_kinase Ig_C17orf99
Motif
Other DBs
NCBI-GeneID: 109563216
NCBI-ProteinID: XP_019822055
Position
8
AA seq 821 aa AA seqDB search
MSSWTRWHGPAMARLWGFCWLIVGFWRAALACPTSCKCSASRIWCGDPSPGIVAFPKLEA
TSADPENITEIYIANQKRLEIINEDDLEAYVGLKNLTIVDSGLKSVAHKAFLKNSNLQHI
NFTRNKLTILSRKHFRHLDLSELILVGNPFTCSCDVMWIKTLQETKPSPETQDLYCLDEN
SKNISLANLQIPHCGLPSANLAAPNLTVEEGKSITLSCTVAGDPVPNLYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYK
LVAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNKSNGTLPT
GVVDTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASPL
HHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLK
RELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIV
KFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIA
AGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMP
PESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQE
VYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctggaccaggtggcatggacccgccatggcgcggctctggggcttctgctgg
ttgattgtgggcttctggagggccgctcttgcctgtcccacatcctgcaagtgcagcgcc
tctcggatctggtgcggcgatccttctcctggcatcgtggcatttccgaagctggaggct
accagtgcagatcctgagaacatcaccgaaatttacattgcaaatcagaaaagattagaa
atcatcaacgaagatgatcttgaagcttacgtgggactgaaaaacctgaccattgtggat
tctggattaaaatctgtggctcataaagcattcctaaaaaacagcaacttacagcacatc
aattttacccgaaataaactgacgattttgtctaggaaacattttcgtcaccttgacttg
tctgagctaatcctggtgggcaacccatttacatgctcctgtgacgttatgtggatcaag
actcttcaagagactaaacctagtccagaaactcaggatttgtactgtctggatgaaaac
agcaagaatatttcactggcaaacctgcagataccccattgtggtttgccatcagcaaat
ttggccgcacctaacctcaccgtggaggagggaaagtctatcacattatcttgtactgtt
gcaggtgacccagttccgaatttgtactgggatgtcggtaatctggtttccaagcatatg
aatgaaacaagccacacacagggctccttaaggataactaacatttcatctgatgacagt
ggaaagcaaatctcttgtgtggcagaaaatcttgtaggagaagatcaagattctgtcaac
ctcactgtacattttgctccaactatcacatttctcgaatctccaacctcagaccaccac
tggtgcattccattcactgtgaaaggcaatcccaagccagcgcttcagtggttctataac
ggggcaattttgaatgagtccaaatacatctgtactaaaatccatgttaccaatcatacg
gagtaccacggctgcctccagctggataaccccactcatatgaacaatggggactacaag
ttagtagccaagaatgaatatgggaaggatgagaaacagatttctgctcacttcatgggc
tggcctggaatcgatgatggtgcaaatccaaattatcctgatgtaatttatgaagattac
gggaccgcagcaaatgacattggggacaccacaaacaaaagtaatggaacccttcccaca
ggtgttgttgacacgggtcgggaacacctctcggtctatgctgtggtggtaattgcatct
gtagtgggattttgtctactggtaatgctatttctgctgaagttggcaagacactccaag
tttggcatgaaaggcccagcctcagttatcagcaatgatgatgactctgccagcccactc
catcacatctccaatgggagtaacaccccgtcgtcttcagagggtggccctgatgctgtc
attattggaatgaccaagattcctgtcattgaaaatccccagtactttggcattaccaac
agtcagctcaagccagacacatttgttcagcacatcaagcgacacaacattgtcttgaaa
agggagctaggtgaaggagcctttggaaaagttttccttgctgaatgctataacctctgt
cctgagcaggacaagatcttggtggccgtgaagacgctgaaggatgccagcgacaatgca
cgcaaggacttccaccgcgaggccgagctgctgaccaacctccagcacgagcacattgtc
aagttctatggcgtctgcgtggagggcgacccactcataatggtcttcgagtacatgaag
cacggggacctaaacaaattcctcagggcgcatggaccggatgcagtgctgatggccgag
ggcaacccaccgacggagctgacgcagtcgcagatgctgcacattgcccagcagatcgct
gcaggcatggtctacctggcatcgcagcacttcgtgcaccgagacctagccacccggaac
tgcctggtgggcgagaatctcctggtgaagatcggggacttcggcatgtcccgggacgtg
tacagcaccgactactacagggttggtggccacacaatgctgcccattcgctggatgccc
ccagagagcatcatgtacaggaagttcaccaccgaaagtgacgtctggagcctgggggtc
gtgttgtgggagatcttcacgtacgggaaacagccctggtaccagctgtcgaacaacgag
gtgatagaatgcatcactcagggccgagtcctgcagcgacctcgaacatgcccccaggaa
gtctacgagctgatgctggggtgctggcagcgagagccccatatgaggaagaacatcaag
ggcatccacaccctccttcagaacttagccaaggcatccccagtctacctggatattcta
gggtag

DBGET integrated database retrieval system