KEGG   Bos indicus (zebu cattle): 109563399
Entry
109563399         CDS       T04792                                 

Gene name
TLR4
Definition
(RefSeq) toll-like receptor 4 isoform X1
  KO
K10160  toll-like receptor 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04064  NF-kappa B signaling pathway
biu04066  HIF-1 signaling pathway
biu04145  Phagosome
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu05132  Salmonella infection
biu05133  Pertussis
biu05134  Legionellosis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05144  Malaria
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05162  Measles
biu05164  Influenza A
biu05170  Human immunodeficiency virus 1 infection
biu05205  Proteoglycans in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05321  Inflammatory bowel disease
biu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109563399 (TLR4)
   04066 HIF-1 signaling pathway
    109563399 (TLR4)
   04151 PI3K-Akt signaling pathway
    109563399 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109563399 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    109563399 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109563399 (TLR4)
   04621 NOD-like receptor signaling pathway
    109563399 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109563399 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109563399 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109563399 (TLR4)
   05321 Inflammatory bowel disease
    109563399 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109563399 (TLR4)
   05135 Yersinia infection
    109563399 (TLR4)
   05133 Pertussis
    109563399 (TLR4)
   05134 Legionellosis
    109563399 (TLR4)
   05152 Tuberculosis
    109563399 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109563399 (TLR4)
   05162 Measles
    109563399 (TLR4)
   05164 Influenza A
    109563399 (TLR4)
   05161 Hepatitis B
    109563399 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109563399 (TLR4)
   05144 Malaria
    109563399 (TLR4)
   05145 Toxoplasmosis
    109563399 (TLR4)
   05140 Leishmaniasis
    109563399 (TLR4)
   05142 Chagas disease
    109563399 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109563399 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:biu04054]
    109563399 (TLR4)
   04090 CD molecules [BR:biu04090]
    109563399 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109563399 (TLR4)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    109563399 (TLR4)
Pattern recognition receptors [BR:biu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   109563399 (TLR4)
CD molecules [BR:biu04090]
 Proteins
  109563399 (TLR4)
Glycosaminoglycan binding proteins [BR:biu00536]
 Hyaluronan
  Cell surface receptors
   109563399 (TLR4)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_5 LRR_9 LRR_6 DUF1863
Other DBs
NCBI-GeneID: 109563399
NCBI-ProteinID: XP_019822383
Position
8
AA seq 841 aa
MMARARLAAXXIPATAILSCLRTESWDPCVQVVPNISYQCMELNLYKIPDNIPISTKMLD
LSFNYLRHLGSHNFSSFPELQVLDLSRCEIKIIEDDTFQGLNHLSTLILTGNPIQSLAWG
AFSGLSSLQKLVAVETNLVSLNDFPIGHLKXLKELNVAHNFIHSFKLPEYFSNLPNLEHL
DLSNNKIQNIYYEDVKVLHQMPLLNLSLDLSLNPLDFIEPGTFKEIKLNGLTLRSNFNSS
HVMKTCIQGLAGLKTNRLVLGEFKNERKLQRFDRSFLEGLCNLTIEQFRIAYLDKFSGDD
TDLFNCLANVSVISLLSISLGSLQALLKDFRWQHLEIINCDFDKFPXLKLSSLKKFVFTD
NKDISTFTEFQLPSLQYLDLKRNHLSFKGCCSHTDFGTTNLKHLDLSFNDVITLGSNFMG
LEQLEHLDFQHSTLKQINAFSAFLSLRNLRYLDISYTNIRIVFHGIFTGLVSLQTLKMAG
NSFQNNLLPDIFTELTNLTVLDLSKCQLEQVAQTAFHSLSSLQVLNMSHNKLLSLDTFLY
EPLHSLRILDCSFNRIMASKEQELQNLPRSLTWLNLTQNAFACVCEHQSFLQWVKDQRQL
LVGAEQMMCAEPLDMEDMPVLSFRNATCQLSKTIISVSVVTVLLVSVVGXLVYKFYFHLM
LLAGCKKYGRGESTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
ANIIQEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKLEKSLL
RQQVELYRLLSRNTYLEWEDSVLGRHVFWRRLRKALLAGKPQSPEGTADAETNPQEATTS
T
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgatggcgcgtgcccgcctggctgcgnnnnngatcccagccacggccatcctctcctgc
ctgagaaccgagagytgggacccttgcgtacaggttgttcctaacattagttaccagtgc
atggagctgaatctctacaaaatccccgacaacatccccatatcaaccaagatgctggac
ctgagctttaactacctgagacatttaggcagccataacttctccagcttcccagaactg
caagtgctggatttatccagatgtgaaattaagattattgaagacgacacatttcagggc
ctaaaccacctctccaccttgatactgacgggaaaccctatccagagtttagcctgggga
gccttttctgggctatcaagtttacagaagctggtggccgtggagacaaacctagtctct
ctaaatgacttccccattggacatctcaaaamcttgaaagagcttaatgtggctcacaat
tttatccattccttcaagttacctgaatatttttctaacctgcccaacctggagcacttg
gatctttctaacaacaaaatccaaaatatttattatgaagatgtgaaagttctacatcaa
atgcccctactcaacctctctttagatttgtccttgaaccctttagactttattgaacca
ggtacctttaaagaaattaagctcaatggattgactctgcgaagtaattttaacagttca
catgtcatgaaaacctgtattcaaggtctggctggtttaaaaaccaaccggctggttttg
ggagaatttaaaaatgaaaggaagttgcaaagatttgacagatctttcctggagggactg
tgcaacctgaccattgaacaattccggatagcgtacttggacaaattctcaggggacgat
acagacttatttaattgtttggcaaatgtttctgtgatttctctgttgagtatatcttta
ggaagtctacaagcccttcttaaagattttagatggcaacacttagaaattattaactgt
gactttgacaagtttcctgmattgaagctcagttctctcaaaaagtttgttttcacagac
aacaaagatataagcacttttactgagtttcagctaccgagccttcagtatctagatctc
aaaagaaatcacttgagtttcaagggktgctgttctcacactgattttgggacaaccaac
ctgaagcatttagatctgagcttcaatgatgtcattaccttaggttcaaacttcatgggc
ttagagcaactagaacacctggattttcagcattccactctgaaacagatcaatgctttt
tcagcattcctatcactcagaaacctccgctaccttgatatttcttataccaacatccgc
attgtcttccatggcatctttactggcttagtcagtctgcaaaccttgaaaatggcaggc
aactcttttcagaacaacttgctccctgacatcttcacagaactgactaacttaaccgtc
ttggacctctctaagtgtcagctggaacaggtagcccagacagcatttcactccctctct
agccttcaggtgctgaatatgagtcacaacaaactcttgtcactggatacatttctttat
gaaccactccactcgctccggatcctagactgcagtttcaaccgtatcatggcctctaag
gagcaagaactacagaatttgccaaggagcctcacttggctaaatcttactcagaatgca
tttgcttgtgtttgtgaacatcagagyttcctgcagtgggtcaaggaccagaggcagctc
ttggtgggagctgagcaaatgatgtgygcagagcctttagatatggaggacatgccagtg
cttagtttcaggaaygccacttgtcagctgagcaagacgatcatcagtgtgtcggtggtc
actgtgctcctggtgtctgtggtaggrrtcctagtctacaagttctatttccacctgatg
cttcttgctggmtgcaaaaagtatggcaggggcgagagcacctatgaygcctttgtcatc
tactcgagccaggatgaagactgggtgcggaatgaactggtaaagaacttggaggagggc
gtgcccccctttcagctctgccttcactacagggactttattcctggggtggccatcgcc
gccaatatcatccaggagggtttccacaaaagccgtaaggttattgtcgtggtgtcccag
cacttcatccagagccgatggtgtatcttcgagtatgagattgcccagacctggcagttt
ctgagcagccgtgctggcatcatcttcatcgtcctgcagaagctggagaagtctctcctg
cggcagcaggtggagctctatcgccttctgagcaggaacacctacctggagtgggaggac
agtgtcctggggcggcatgtcttctggagaagactcagaaaagccttgctggctggtaaa
ccccagagtccagaaggaacagcagatgcagaaaccaacccgcaagaagcgacaacctcc
acctga

DBGET integrated database retrieval system