KEGG   Bos indicus (zebu cattle): 109563408
Entry
109563408         CDS       T04792                                 

Gene name
TRAF1
Definition
(RefSeq) TNF receptor-associated factor 1 isoform X1
  KO
K03172  TNF receptor-associated factor 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04064  NF-kappa B signaling pathway
biu04210  Apoptosis
biu04668  TNF signaling pathway
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05203  Viral carcinogenesis
biu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109563408 (TRAF1)
   04668 TNF signaling pathway
    109563408 (TRAF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109563408 (TRAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109563408 (TRAF1)
   05202 Transcriptional misregulation in cancer
    109563408 (TRAF1)
   05203 Viral carcinogenesis
    109563408 (TRAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109563408 (TRAF1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd
Other DBs
NCBI-GeneID: 109563408
NCBI-ProteinID: XP_019822401
Position
8
AA seq 415 aa
MASGSASSXXAAPDENEFPFGCPPTACQDPPEPGPVCCAVCLSEKVRNDEDRICPKCKGD
DTPSESPGSLLSQEKDHPEVAEAGVGCPFAGVGCSFKGSPKFMEEHEVTSQAAHLNLLLG
FMKQWKAQLGSGLGYGPMALERNLSDLQLXXAVEVAGDLEVDCYRAPCSESQDELALHHF
MKEKLLNELEGKLCVFENIVAVLNKEVEASPLALAASIHQSQLDREHILSLEQRVLELQQ
TLAQKDQALGKLEQSLRLVEEASYDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKY
GYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDA
FRPDLNSASFQRPQSETNVASGCPLFFPLNKLQSPKHAYVKDDTMFVKCVVDTNT
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcctctggctcagccagcagtcnnngtgcggcccccgatgagaacgagttccccttt
gggtgcccccccactgcctgccaggaccccccagagcccggccctgtctgctgcgccgtc
tgtctctctgagaaagtgaggaatgacgaggatcggatctgtcccaaatgcaaaggggat
gacaccccatctgaaagtccaggaagccttctgtctcaggagaaggatcaccccgaggtg
gctgaggctggagttgggtgcccctttgcaggtgtcggctgctccttcaagggaagccca
aagttcatggaggagcatgaggtcacctcccaggccgcccacctgaacctgctgttgggg
ttcatgaagcagtggaaggcccagctgggctctggcctggggtaygggcccatggccctg
gaacggaacctgtcagacctgcagctnnnnnnggccgtggaggtggccggggacctggag
gtggactgctaccgggccccctgctccgagagccaggacgagctggccctgcatcacttc
atgaaggagaagctcctgaacgagctggaagggaagctgtgtgtgttcgagaacattgtc
gctgtcctcaacaaggaggtggaggcctcccccctggccctggccgcctccattcaccag
agccagctggaccgcgaacacatcctgagcctggagcagagggtgttggagttgcagcag
accctggcccagaaggaccaggccttgggcaagctggagcagagcctgcgcctcgtggag
gaggcctcctacgayggcaccttcctctggaagatcaccaacgtcacccgccgatgccat
gagtcggcctgtggcaggaccgtcagcctcttctccccagctttctacaccgccaagtac
ggatacaagctgtgcctgcggctctacctgaatggggatgggacggggaagaggacccac
ctgtccctcttcatcgtgatcatgagaggggagtatgatgctctgctgccatggcctttc
aggaacaaggtcaccttcatgctgctggaccagaacaaccgtgaacacgccatcgacgcc
ttccggcccgacctgaactccgcttccttccagcggccccagagcgagaccaacgtggcc
agcggctgcccgctcttcttccccctcaacaagctgcagtcgcccaagcacgcctacgtg
aaggacgacaccatgttcgtcaagtgcgtcgtggacactaacacttag

KEGG   Bos indicus (zebu cattle): 109566626
Entry
109566626         CDS       T04792                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04064  NF-kappa B signaling pathway
biu04071  Sphingolipid signaling pathway
biu04141  Protein processing in endoplasmic reticulum
biu04210  Apoptosis
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04668  TNF signaling pathway
biu04920  Adipocytokine signaling pathway
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05014  Amyotrophic lateral sclerosis
biu05016  Huntington disease
biu05017  Spinocerebellar ataxia
biu05132  Salmonella infection
biu05135  Yersinia infection
biu05160  Hepatitis C
biu05163  Human cytomegalovirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109566626 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109566626 (TRAF2)
   04064 NF-kappa B signaling pathway
    109566626 (TRAF2)
   04668 TNF signaling pathway
    109566626 (TRAF2)
   04071 Sphingolipid signaling pathway
    109566626 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109566626 (TRAF2)
   04217 Necroptosis
    109566626 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109566626 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    109566626 (TRAF2)
   04657 IL-17 signaling pathway
    109566626 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109566626 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109566626 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109566626 (TRAF2)
   05203 Viral carcinogenesis
    109566626 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109566626 (TRAF2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109566626 (TRAF2)
   05014 Amyotrophic lateral sclerosis
    109566626 (TRAF2)
   05016 Huntington disease
    109566626 (TRAF2)
   05017 Spinocerebellar ataxia
    109566626 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109566626 (TRAF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109566626 (TRAF2)
   05135 Yersinia infection
    109566626 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109566626 (TRAF2)
   05160 Hepatitis C
    109566626 (TRAF2)
   05168 Herpes simplex virus 1 infection
    109566626 (TRAF2)
   05163 Human cytomegalovirus infection
    109566626 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109566626 (TRAF2)
   05169 Epstein-Barr virus infection
    109566626 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:biu03019]
    109566626 (TRAF2)
   04121 Ubiquitin system [BR:biu04121]
    109566626 (TRAF2)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109566626 (TRAF2)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     109566626 (TRAF2)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    109566626 (TRAF2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-RING_6 zf-C3HC4_2 zf-C3HC4_3 zf-C3HC4_4
Other DBs
NCBI-GeneID: 109566626
NCBI-ProteinID: XP_019826721
Position
11
AA seq 516 aa
MAAASVTPPGSLDLLQPGFSKTLLGTKLEDKYLCSACKNVLRRPFQAQCGHRYCSFCLSS
ILSSGPQSCAACVHEGIYEEGVSILESSSAFPDNAARREVESLPAVCPSEGCSWKGTLKD
YESCHEGQCPFMLTECPACKGLVRLGEKEHHLEHQCPERSLSCRHCXXXFSPADMKAHHQ
ICPKFPLTCDGCGKKKIAREKFQDHVRACGRCRVPCRFHAVGCPEMVESEQQPEHEAQRL
QEHLALLLGVLLEAGRPPGDSRLLLRPGEGALEAGTPSRVAELLQRCEALERKTATFENI
VCVLNREVERVAVTAEACGRQHRLDQDRIEALSNKVQQLERSIGLKDLAMADLEQKVLEM
EASTFDGVFIWKISDFSRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRAYLNGDGTGRGT
HLSLFFVLMRGPHDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVGDMNI
ASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggctgcagccagcgtgacccctcccggctccctggacctactgcagcccggcttctcc
aagactctcctggggaccaagctagaggacaagtacctgtgctcggcctgcaagaacgtg
ctgcgcagacccttccaggctcagtgtggccatcgctactgctccttctgcctgagcagc
atcctgagctccgggccccagagctgcgccgcctgcgtgcacgagggcatttacgaggag
ggcgtctcaatcctggagagcagctcggcgtttccggacaatgctgcccgcagggaggtg
gagagcctgccggccgtctgccccagcgagggctgctcctggaaggggaccctgaaggac
tacgagagctgccacgaaggacagtgcccgttcatgctgaccgagtgcccggcgtgcaaa
ggcctcgtgcgcctgggcgagaaggagcaccacctggagcaccagtgcccggagcggagc
ctcagctgccggcactgcannnnnnccttctcccctgccgacatgaaggcgcaccaccag
atctgccccaagttccccttgacgtgcgacggctgcggcaagaagaagatcgcccgtgag
aagtttcaggaccacgtccgggcgtgtggcagatgccgagtcccgtgccgattccacgct
gttggctgccccgagatggtggagagcgagcagcagccggagcacgaggcgcagcggctc
caggagcacctggccctgctgctgggcgtcctgctggaggctgggcggcccccgggggac
agccgcctgctcctcaggccaggcgagggcgccttggaggccggcacaccctccagggtg
gcggagctgctgcagaggtgcgaggccctggagcggaagacagccaccttcgagaacatc
gtctgtgtgctgaaccgggaggtggagcgggtggccgtgacggctgaggcctgcggccgg
cagcaccggctggaccaagacaggatcgaggccctgagcaacaaggtgcagcagctggag
aggagcatcggcctgaaggacctggccatggccgacctggagcagaaggtcctcgagatg
gaggcgtccacctttgacggcgtgttcatctggaagatctcggacttctccaggaagcgc
caggaagccgtggccggccgcacgcccgccatcttctccccagccttctacaccagcagg
tacggctacaagatgtgcctgcgcgcctacctcaacggggacggcacggggcgcggcacg
cacctgtccctcttcttcgtgctaatgcgtggcccgcacgacgccctcctgcgctggccc
ttcaaccagaaggtgaccctgatgctgctggaccagaacaaccgggagcatgtgatcgac
gccttcaggcccgacgtgacctcgtcctccttccagaggccggtcggcgacatgaacatc
gccagcggctgcccgctcttctgccctgtctccaagatggaggccaagaactcctacgtg
cgtgacgacgccatcttcatcaaggccatcgtggacctgaccgggctctag

DBGET integrated database retrieval system