KEGG   Bos indicus (zebu cattle): 109563409
Entry
109563409         CDS       T04792                                 

Gene name
C5
Definition
(RefSeq) complement C5
  KO
K03994  complement component 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04080  Neuroactive ligand-receptor interaction
biu04610  Complement and coagulation cascades
biu05020  Prion disease
biu05133  Pertussis
biu05150  Staphylococcus aureus infection
biu05168  Herpes simplex virus 1 infection
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109563409 (C5)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109563409 (C5)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109563409 (C5)
  09164 Neurodegenerative disease
   05020 Prion disease
    109563409 (C5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109563409 (C5)
   05150 Staphylococcus aureus infection
    109563409 (C5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109563409 (C5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109563409 (C5)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   109563409 (C5)
SSDB
Motif
Pfam: TED_complement MG1 MG4 A2M NTR A2M_BRD A2M_recep MG2 MG3 ANATO Big_1 NUP
Other DBs
NCBI-GeneID: 109563409
NCBI-ProteinID: XP_019822407
Position
8
AA seq 1677 aa
MGLWGILCFLIFLGKSWGQEQTYVISAPKVFHVGAYENVVIQAYGYTEEFDATVSIKSFP
DKKVTYSSGHVTLSAENKFQNSATLTIQPKQLSERQSSVSHVYLEVTSKHFSKAKKMPVT
YDNGFLFIHTDKPVYTPHQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEENDYT
GIISFPDFKIPSNPKYGVWTIRAKYKEDFSTTGTAYFEIKEYVLPHFSISIEPKSNFIGY
KDFTNFEITIRARYFYNKVVNEADVYITFGIRDNLEDNQKEMMQKAMQSTXLINGMAQVT
FNSETAVKELSYESLEDLNNKYLYIGVTIIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFVKPGIPYSVKVQVKDSFDHLVGGIPVTLSAKTLDANQEITDLESKKSVTRSSDGVASF
VVNLPSEVTVLEFNIKTEDLDLPEENQASEDYRAVAYSSLSQSYLYIDWTENYKHLLVGA
HLNIVVTPRSPYIDKITHYNFLILSKGKIVHFGTRDKLSDSAYQSINIPVTQDMVPSARL
LVYYIVTGEQTAELVSDSVWLNIEEKCGNQLEVHLSPETDAYSPGQRVSLNMETELDSWV
ALTAVDSAIYGVQRTAKRPLERVFQTLEKGDLGCGAGGGRDNAEVFYLAGLTFLTNANAD
DTRENDEPCKEILRPKRMLKKKIEEEAAKYRNAWVKKCCYDGAHRNDDETCEQRAARIQA
GPICIKAFKSCCAIASQFRADEHHKNMQLGRLHIKSLLPVTKPEIRSYFPESWLWEVHRV
PKRNQLQFVLPDSLTTWEIQGVGISNSGICVADTLKAKVFKSVFLEMNIPYSVVRGEQXQ
LSGTVYNYRTSGIQFCVKMHPVEGICSSGTPVTDSQGRRFSKCVLQKIEGSSNHLVTFTV
LPLEVGLHNLSFSLETSVGNEILVKTLRVVPEGVKRESYAGVTLDPQGVYGIISRRKEFP
YRIPLNMVPKTKVKRTVSIKGLLIGEIMSAVLSQEGIDSLTRLPKGNAEAELMSVVPVFY
VYHYLEAGHNWDIFSTNSLTQKQNLKTKLKEGMVSIMSFRNADYSYSMWKGGSASTWLTA
FALRVLGQISKYVDQNQNSICNSLLWLLEKCQLENGSFKENSDYQPVKLQGTLPVEAREK
TLYLTAFAVIGIRKAFDICPLEKISTAVSKADIFLHENALSSQSAFTLAIAAYALSLGDK
AHPQFRAIVSALKRKAFVKGNPPIYRFWKDDLQQRDSFXPNTGTARMVETTAYALLTNLN
LKDMNYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVRKLRLNMDVKVSYKNK
GDLYHYKMSDKYFLGRPIEVPLNDDLVVLSTGQSSGLATVHVKTVVHKISTSEEVCSFHL
KIETREIEAFGYSSSEYKRIVACASYKLSSEESSSGSSHAVMDISLPTGVNANPEDLKAL
VEQVDQLLTDYEIKDGHVILQLNSIPSNEFLCVRFRIIELFEVGFLSPATFTVYEYHRPD
KQCTMFYSTSNTKLQKVCEGVTCKCIEADCGQMQAELDLTISGATRKETACKPEIAYAYK
VEIVAVTEENAFVKYTATLLDIYKAGEAAAERDAEITFIKKTSCSNTNLEKRKQYLIMGK
EALQIKHNFRFKYVYPLDSSTWIEYWPTDSRCPSCQRFLANLDEFTEDIFLNGCENA
NT seq 5034 nt   +upstreamnt  +downstreamnt
atgggcctgtggggcatactttgttttttaatcttcctggggaaaagttggggccaggag
caaacgtatgtcatttcagcaccaaaagtattccatgttggagcatatgaaaatgttgta
attcaagcttatggatacactgaagaatttgatgcaacagtctcaatcaaaagctttccc
gacaaaaaagttacttactcttcaggccatgttactttatctgcagaaaataaattccaa
aattcggctaccttaacaatacaacccaaacagttgtctgaaagacaaagctccgtttca
catgtgtatctggaagttacatcaaagcatttttcaaaagcaaaaaaaatgccagtaacc
tacgacaatggattcctcttcattcacacagacaaacctgtgtacaccccacaccagtca
gtaaaggttagagtttattcactgaatgatgacctgaagccagccaaaagagaaacggtc
ttaactttcatagatcccgaaggatcagaagttgacatggtagaagaaaatgattatact
ggaattatttcttttcctgacttcaagattccatctaatcctaaatayggtgtgtggacc
attcgagctaaatataaagaagacttttcaacaactggaaccgcatattttgaaattaaa
gaatatgtgttgccacatttttctatctcaatagaaccaaaaagtaatttcattggttat
aaggactttactaattttgaaattactataagagcaagatatttttataataaagtcgtc
aacgaggctgacgtttayatcacttttggaataagagacaacttagaagataatcaaaaa
gaaatgatgcaaaaagcaatgcaaagcacakcgttgataaacggaatggctcaagtcaca
tttaactctgaaacagcagttaaagaattgtcctatgaaagtctagaagatttaaacaac
aagtacctctatatcggtgtgacaatcatagagtctacaggtggattttctgaagaagca
gaaattcctggcatcaaatatgtcctttctccctacaaactgaatttggttgctacycct
ctttttgtgaagcctgggattccatattctgtcaaggtgcaagttaaggattcatttgac
catttggtaggagggatcccggtgaccctgagcgcaaaaacgctcgacgcgaaccaagag
ataactgacttggagtcgaagaaaagtgtaacacgttccagtgacggagtagcttctttt
gtggtgaatctcccatctgaagtgacggtgctggagttcaatatcaagaccgaggatcta
gatcttcccgaagaaaatcaggccagtgaagattaccgagcagtagcgtattcatctctc
agccaaagctacctttatattgactggacagaaaactataaacatttgcttgtgggagca
catctgaatattgttgttacacccagaagtccgtatattgacaaaataactcactacaat
ttcttgattttatccaagggcaaaattgttcactttggcacaagggacaaactttcggat
tcagcttatcaaagcataaacatcccggtgacgcaggacatggtcccttccgctcgcctt
ctggtctattacatcgttacaggagagcagactgcagaattagtgtccgactcagtctgg
ttgaatattgaggaaaagtgtggcaaccagcttgaggttcatctgtctccagagacagat
gcatattcccctggccaacgtgtatctcttaatatggaaactgagttggattcctgggtg
gctttaacagcagtggacagtgctatatatggagtgcaaaggacagccaagagacccctg
gaaagagtatttcaaactttagagaagggtgacctgggctgtggggcaggcggtggccga
gacaatgcagaggtgttctacctagctggactcactttcctcaccaacgcaaacgcagat
gacacccgagaaaacgatgaaccttgtaaggaaattctcaggccaaagagaatgctgaaa
aagaagatagaggaagaagctgctaaatacagaaacgcatgggtgaagaagtgttgttat
gatggagcccatcggaatgatgatgaaacctgtgagcagcgagccgctcggattcaggca
ggccccatatgtatcaaagctttcaagagctgttgtgccatcgcaagccagttccgggct
gatgagcatcacaaaaatatgcaactaggaaggctgcatataaagtctcttttaccagta
accaaaccagaaataagaagctattttccagaaagctggctatgggaagttcatcgtgtc
ccgaaaaggaaccaattgcagtttgtgctacctgattctctaactacctgggaaattcaa
ggtgttggaatttcaaatagcggtatatgtgttgctgatactctgaaagcaaaagtgttc
aaaagcgtcttcctggaaatgaatataccatattctgtggtacgaggggaacagrtccaa
ctgagtgggactgtttacaactayagaacatctggaattcagttctgtgttaaaatgcat
cctgtggaggggatctgttcatcaggaaccccagtcactgactctcaggggagaagattc
tccaagtgtgtgctccagaaaatcgagggttcctccaaccacttggtcaccttcactgtg
cttcctctggaagtcggcctccacaacctcagcttctcactggagacttcggttggaaat
gaaatcttagtaaaaacactacgagtggtgccagaaggtgtcaaaagggaaagctatgct
ggtgttactctggatccacagggtgtctatggcatcattagcaggcgaaaggagttccca
tacaggataccattaaatatggtccccaaaacaaaagtcaaaagaactgtgagtataaaa
ggactgcttataggcgagatcatgtctgcagtcctgagtcaggaaggcattgatagtctt
acccgcctccccaaaggcaacgcagaggcggagctgatgagcgtggtcccagtgttctat
gtttatcactacctggaggcgggacataattgggacatcttttctacgaactcattaact
caaaaacagaacctgaagacaaaattaaaagaagggatggtgagcatcatgtccttcaga
aatgctgactattcctacagcatgtggaagggtggcagtgctagcacttggttaacagct
tttgctctaagagtacttggacaaataagtaaatatgtagatcagaaccaaaattcgatt
tgtaattctttattgtggctgcttgagaaatgtcagctggaaaatggatcattcaaggaa
aattccgactatcaacctgtgaagttacaggggaccttgcctgttgaagcccgagagaag
actttgtatctcacagcctttgctgtgattggcattagaaaggcttttgatatatgcccc
ttggagaaaatcagcacggctgtaagtaaagctgacatctttctgcatgaaaatgccctc
tcatcccagagtgcttttacactggccatcgctgcttacgctctttccctaggagataaa
gcacacccgcagtttcgtgcaattgtctctgctctgaagaggaaagctttcgtcaaaggt
aatccacctatttatcgtttctggaaagatgatcttcagcagagagacagctttgygccc
aacactggcacagctcgtatggtagaaaccacggcctacgccttactcaccaatctgaac
ttgaaagacatgaattacgtgaacccagtcatcaaatggctatcggaagagcagagatay
ggaggcggcttttattcaacccaggatacaattaatgccatcgagggcctgacagagtat
tcactcctggttagaaaactccgcttgaacatggatgtcaaagtgtcttacaagaataaa
ggtgacctctaccactataagatgtcagacaagtatttccttgggaggccaatagaggta
cctctcaatgatgacctcgtcgtcctragtacyggacaaagcagtggcttggctacagtg
catgtaaaaactgtggttcacaaaatcagcacctcggaggaagtttgcagcttccatttg
aaaattgaaacccgggaaattgaagccttcggctacagcagctcagaatacaagcgcata
gtggcctgcgccagctacaagctcagcagtgaggaatcgtcatctgggtcctctcacgcg
gtaatggatatctctctgcctaccggagtcaacgcaaacccagaagacttaaaagctctt
gtggaacaggtggatcaattattaactgactacgaaatcaaagatgggcatgttattctg
caactgaactcgattccttccaacgagttcctttgtgttcgattccggataattgaactt
tttgaagttgggtttctgagccctgccaccttcacagtgtatgagtaccacagaccagat
aaacagtgcaccatgttttacagcacgtcgaacaccaagcttcagaaagtctgtgaagga
gtaacgtgcaaatgtatcgaagctgactgtgggcaaatgcaggcagaattggacctgaca
atctctggagctactagaaaggaaacagcatgtaaaccggagattgcatacgcttataaa
gttgagatcgtagctgtcactgaagaaaatgcttttgttaagtacacggcaactctcctg
gatatctacaaagctggagaagctgctgctgagagagacgctgaaatcaccttcattaaa
aagacaagctgctccaacaccaatctggaaaaaagaaaacagtacttaatcatgggtaaa
gaggccctgcagataaaacacaacttccgtttcaagtacgtctacccgttagattcctcg
acctggattgaatattggcctacagactccaggtgtccatcgtgccagagatttttagcg
aatctagatgagtttactgaagacatctttttaaatggctgtgaaaacgcctaa

DBGET integrated database retrieval system