KEGG   Bos indicus (zebu cattle): 109563514Help
Entry
109563514         CDS       T04792                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00970  Aminoacyl-tRNA biosynthesis
biu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109563514
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:biu03029]
    109563514
Enzymes [BR:biu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     109563514
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     109563514
Mitochondrial biogenesis [BR:biu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    109563514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 109563514
NCBI-ProteinID: XP_019822466
Position
9
AA seq 437 aa AA seqDB search
MSGDVAEATQEEARLVADKGDHIKRVLLRYLALLLHLRSGSTDGIFGPVKNPWSYSKQYR
EKRKQNSHSENEDSNWLITGGSSGGSAAAVSAFTCFAALGSDTGGSTRNPAAHCGVVGLK
PSYGLVSRHGLIPLVNSMDVPGILTRCVDDAATVLGVLAGHDPKDSTTIQDPVKPFTLPS
LTDVSKLCIGIPKEYLTPELSSEVQSLWSKAANLFESEGAKVTEVSLPHTSYSIVCYHVL
CTSEVASNMARFDGLEYGHRCDSDVSTEAMYAATRREGFNDVVRGRILSGNFFLLKENYE
NYFVKAQKVRRLIANDFVNVFNSGVDVLLTPTTLSEAVPYTEFIKEDNRTRSAQDDIFTQ
AVNMAGLPAVSVPVALSSQGLPIGLQFIGRAFCDQQLLIVAKWFEKQVQFPVIQLQELMD
DCSSVFENEKLASVSLK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagatgtggctgaggccacacaggaagaggcaaggctagttgctgataaagga
gatcacataaaaagagttttattaagatatcttgctttacttcttcatctcagatctgga
agcacagatggcatatttggaccagttaaaaacccgtggagttattcaaaacaatataga
gaaaagaggaagcaaaactctcacagtgagaatgaggattcaaattggcttataaccgga
ggaagctcaggaggaagtgcrgcggccgtgtcggcgttcacgtgctttgcggctttagga
tcagatacgggaggatcaaccagaaatccagctgcccactgcggggttgttggtttaaaa
ccaagctatggcctagtttctcgtcatggtctcattcccctggtgaattcaatggatgtg
ccaggaatcttaaccagatgtgtggatgatgcagccactgtgttgggtgtactagctggg
catgatcccaaagattctaccacaattcaagatcctgttaaaccatttacgcttcccagt
ttgacagatgtgagcaaactatgtataggaattccaaaggagtatcttacgccagaattg
tcaagtgaagtacaatctctttggtccaaagctgctaatctctttgagtctgagggggcc
aaagtaactgaagtctccctgccccataccagctactcaattgtgtgctaccacgtattg
tgcacgtcggaagtggcatcgaatatggccagatttgatgggctagaatatggtcacaga
tgtgatagtgatgtgtctactgaagccatgtatgctgcaaccaggcgagaagggttcaat
gatgtggtgagagggagaatcctctcaggaaactttttcctattaaaagaaaattatgag
aattattttgtcaaagcacagaaagtgagacggctcattgctaatgattttgttaatgtt
tttaactctggagtggacgtgctgctaactcccacgaccttgagtgaggcagtgccgtac
acagagttcatcaaggaagacaacaggacgcgcagcgcccaagacgacatctttacacag
gccgtgaatatggcaggactgccagcagtgagtgtccctgtggccctctcaagccaaggg
ttgccaataggactgcagtttattggacgtgcattttgtgaccagcagcttcttatagtt
gccaaatggtttgaaaaacaagtccagtttcctgttattcaacttcaagaactaatggat
gattgttcatcagtctttgaaaatgaaaagttggcttctgtttctctaaaatag

DBGET integrated database retrieval system