KEGG   Bos indicus (zebu cattle): 109563811
Entry
109563811         CDS       T04792                                 

Gene name
FYN
Definition
(RefSeq) tyrosine-protein kinase Fyn isoform X1
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04360  Axon guidance
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04520  Adherens junction
biu04611  Platelet activation
biu04650  Natural killer cell mediated cytotoxicity
biu04660  T cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04725  Cholinergic synapse
biu05020  Prion disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    109563811 (FYN)
   04071 Sphingolipid signaling pathway
    109563811 (FYN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109563811 (FYN)
   04520 Adherens junction
    109563811 (FYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109563811 (FYN)
   04650 Natural killer cell mediated cytotoxicity
    109563811 (FYN)
   04660 T cell receptor signaling pathway
    109563811 (FYN)
   04664 Fc epsilon RI signaling pathway
    109563811 (FYN)
  09156 Nervous system
   04725 Cholinergic synapse
    109563811 (FYN)
  09158 Development and regeneration
   04360 Axon guidance
    109563811 (FYN)
   04380 Osteoclast differentiation
    109563811 (FYN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    109563811 (FYN)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109563811 (FYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109563811 (FYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109563811 (FYN)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     109563811 (FYN)
Protein kinases [BR:biu01001]
 Non-receptor tyrosine kinases
  SRC family
   109563811 (FYN)
Membrane trafficking [BR:biu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    109563811 (FYN)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    109563811 (FYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3 zf-RING_14
Other DBs
NCBI-GeneID: 109563811
NCBI-ProteinID: XP_019822750
Position
9
AA seq 537 aa
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHGAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggacaaagaagcaacaaaactgacggaggagagggatggc
agtctgaaccagagctccgggtaccgctatggtacagaccccactcctcagcactacccc
agcttcggtgtgacctccatcccgaactacaacaacttccacggggccgggggccaagga
ctcaccgtctttgggggtgtgaactcttcgtctcatactgggaccttgcgaacaagagga
ggaacaggagtgaccctgtttgtggccctttatgactatgaagcacggacggaagatgac
ctgagttttcacaaaggagaaaaatttcaaatattgaacagctcggaaggagattggtgg
gaagcacgctccttgacaactggagagacgggttacattcccagcaattatgtggctcca
gttgactccatccaggcagaagagtggtactttggaaaactcggccggaaagatgctgag
cgacagcttttgtcctttggaaacccacggggtacctttcttatccgtgagagtgaaacc
accaaaggtgcctattcactttctatccgagactgggatgatatgaaaggagaccatgtc
aaacattataaaattcgcaaacttgacaacggtggatactatattaccacccgggcccaa
tttgaaacccttcagcagcttgtacaacattactcagagagagctgcaggcctctgctgc
cgcctagtagttccctgtcacaaagggatgccacggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaacacaaaagtagccataaagact
cttaaaccaggcacaatgtcccctgaatcattccttgaggaggcgcagatcatgaagaag
ttgaagcacgacaaactggtccagctatatgccgtggtgtccgaggagcccatctacatc
gtcaccgagtatatgaataaaggaagtttactcgatttcttgaaagatggggaaggaagg
gctctgaaattaccaaacctcgtggacatggcagcacaggttgccgcgggaatggcgtac
atcgagcgcatgaattacatccacagagacctgcggtcagcaaacattctcgtggggaat
ggactaatttgcaagatcgccgacttcggattggccaggttgatcgaggacaatgagtac
acagcaagacaaggcgccaagttccccatcaagtggacggcccccgaagcagccctgtac
gggaggttcacaatcaagtctgacgtgtggtcttttggaatcttactcacagagctggtc
accaaaggaagagttccgtacccaggcatgaacaaccgggaggtgctggagcaggtggag
cgcggttacaggatgccctgtccacaggactgccccatctccctccacgagctcatgata
cactgctggaaaaaggaccccgaagagcggcccactttcgagtacctgcagggcttcctg
gaagactacttcaccgcaacagagcctcagtatcaacccggggaaaacctgtaa

DBGET integrated database retrieval system