KEGG   Bos indicus (zebu cattle): 109564099
Entry
109564099         CDS       T04792                                 

Gene name
PLG
Definition
(RefSeq) LOW QUALITY PROTEIN: plasminogen
  KO
K01315  plasminogen [EC:3.4.21.7]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04080  Neuroactive ligand-receptor interaction
biu04610  Complement and coagulation cascades
biu05150  Staphylococcus aureus infection
biu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109564099 (PLG)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109564099 (PLG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109564099 (PLG)
  09172 Infectious disease: viral
   05164 Influenza A
    109564099 (PLG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109564099 (PLG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109564099 (PLG)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.7  plasmin
     109564099 (PLG)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109564099 (PLG)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109564099 (PLG)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 109564099
NCBI-ProteinID: XP_019823222
Position
9
AA seq 804 aa
MEHKAVVFLLLLFLKSGLGDLLDDYVNTQGASLLSLSRKNLAGRSVEDCAAKCEEETDFV
CRAFQYHSKEQQCVVMAENSKNTPVFRMRDVILYEKRIYLLECKTGNGQTYRGTTAETKS
GVTCQKWSATSPHVPKFSPEKFPLAGLEENYCRNPDNDENGPWCYTTDPDKRYDYCDIPE
CEDKCMHCSGENYEGKIAKTMSGRDCQAWDSQSPHAHGYIPSKFPNKNLKMNYCRNPDGE
PRPWCFTTDPQKRWEFCDIPRCTTPPPSSGPKYQCLKGTGKNYGGTVAVTESGHTCQRWS
EQTPHKHNRTPENFPCKNLEENYCRNPNGEKAPWCYTTNSEVRWEYCTIPXCESSPLSTE
RMDVPVPPEQTPVPQDCYHGNGQSYRGTSSTTITGRKCQSWSSMTPHRHLKTPENYPNAG
LTMNYCRNPDADKSPWCYTTDPRVRWEFCNLKKCSETPEQVPAAPQAPGVENPPEADCXI
GXGKSYRGKKATTVAGVPCQEWAAQEPHXHSIFTPETNPQSGLERNYCRNPDGDVNGPWC
YTMNPRKLFDYCDVPQCESSFDCGKPXVEPKKCSGRIVGGCVSKPHSWPWQVSLRRSSXH
FCGGTLISPKWVLTAAHCSGQVXLSFYKVILGAHXEKVREQSVQEIPVSRLFREPSQADI
ALLKLSRPAIITKEVIPACLPPPNYMVAARTECYITGWGETQGTFGEGLLKEAHLPVIEN
KVCNRNEYLDGRVKPTELCAGHLIGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCAR
PNKPGVYVRVSPYVPWIEETMRRN
NT seq 2415 nt   +upstreamnt  +downstreamnt
atggaacataaggcggtggtgttcctacttctcttatttctgaaatcaggtctcggagac
ctcctggatgactatgtaaacacccagggggcttccctgcttagtttgagtcggaagaac
ctggcgggaagaagygtagaggactgtgcagccaagtgtgaggaggagacagacttcgtt
tgcagggcattccagtaccacagtaaagagcaacaatgcgtcgtaatggccgaaaacagc
aagaacacccccgtctttaggatgagggatgtcattctatatgagaagagaatctacctt
ttggagtgcaagaccggaaatgggcagacctacagagggaccacagccgaaacaaaaagt
ggggtcacctgccaaaaatggagcgccacttctccacacgtgcccaagttttcgcctgaa
aaatttcctctagcgggactggaggagaactattgcaggaatccagacaatgatgagaat
gggccctggtgttacaccacagatccagacaagagatatgactactgtgacattcccgaa
tgtgaagataaatgtatgcattgcagtggagaaaactatgagggcaagattgccaagacc
atgtctggacgtgactgccaggcttgggactctcagagcccacatgcccacggatacatt
ccttccaaatttccaaacaagaatctgaagatgaactactgccgtaatcctgatggggag
ccccgcccatggtgtttcaccaccgacccccaaaagcgctgggaattctgtgacatcccg
agatgtaccacacccccgccatcttctgggccgaagtatcagtgtctgaagggaaccggc
aaaaactatggagggacggtggccgtcaccgagtccgggcacacatgtcagcgctggagc
gagcagacaccccacaaacacaacaggaccccagaaaactttccatgcaaaaacttggag
gaaaactactgtcgtaaccctaatggggagaaagccccatggtgttatacaaccaacagc
gaagtgaggtgggaatactgcacaatcccgscctgcgagtcctctccgttatccacggaa
cgcatggatgtcccagtaccacccgaacaaactcctgtgccccaggactgctaccatggt
aacgggcagagttatcgaggcacgtcgtccactactatcacaggaaggaaatgccagtcg
tggtcatcgatgacaccacacaggcatctgaagaccccagaaaactacccaaatgcyggc
ttgacaatgaactactgcagaaatccagatgccgataagagcccctggtgttataccacc
gatccgagagtcagatgggagttctgcaacctgaagaaatgttcagaaactccagagcag
gtgcctgcggctccccaagccccaggcgtagagaatcctcctgaagcagactgcakgatc
gggaygggcaaaagctaccgcggcaagaaggccaccacggtggccggtgtcccctgccag
gagtgggcggcccaggagccccaccamcacagcatcttcactccagagacaaacccacag
tcagggctggagagaaactactgccgtaatcctgacggtgatgtcaaygggccctggtgc
tacaccatgaacccaaggaagctttttgactactgtgacgtccctcagtgtgagtcctca
ttcgactgtggaaagcccmaagtggagccgaagaaatgttctggaaggattgtaggtggg
tgtgtgtccaagccacactcttggccctggcaagtcagccttcgaagaagctcgargcac
ttctgyggaggaactctgatatccccaaagtgggtgctgactgctgcccattgctctgga
caagtatsgctgtcattctacaaggtcatcctgggtgcacacwacgagaaagtccgggaa
cagagtgtccaggaaataccagtgtccaggctgttccgggagccctctcaggcggacatt
gccttactcaagctgagcagacctgccatcatcacgaaagaggtaatcccagcttgtctg
ccacccccgaactacatggttgcagcccggacagaatgttacatcactggctggggagaa
acccaaggcacttttggtgagggcctcctgaaggaagcgcacctgcctgtgatcgagaac
aaggtgtgtaatcgcaacgagtatctcgacgggagggtcaagcccacggagctgtgtgcc
ggccatctgattggagggactgacagctgccagggtgacagcggcgggcctctggtctgc
tttgagaaggacaaatacattctgcaaggagtcacttcttggggtcttggctgtgcacgc
cccaataagcctggtgtgtatgttcgtgtttccccctatgttccttggattgaagaaact
atgagaaggaattaa

DBGET integrated database retrieval system