KEGG   Bos indicus (zebu cattle): 109564194
Entry
109564194         CDS       T04792                                 

Gene name
NEO1
Definition
(RefSeq) neogenin
  KO
K06766  neogenin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04350  TGF-beta signaling pathway
biu04360  Axon guidance
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109564194 (NEO1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109564194 (NEO1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    109564194 (NEO1)
SSDB
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set Interfer-bind C2-set_2 Ig_5 fn3_2 Ig_4 Tissue_fac EphA2_TM SusE TMEM154 Herpes_UL74 Ly49 FAM176 Shisa
Other DBs
NCBI-GeneID: 109564194
NCBI-ProteinID: XP_019823300
Position
10
AA seq 1757 aa
MVFSQNIFHGCNLYDFXYSQQPCKDKLLSPKFGWPGSTSRLLSGLQSQPPAPGSPAKRCD
FLVRKREVARKRRGKRSQLQPADRPKAGHGVPPRPPHRLVERTPAPLFALRFPGPRPRAA
GGGAGPADLALSRGSSRRGRPGREAGGQRRRGGPPPTGAAPGPSKSRAGSLFQRXLGEVR
RAARREGVCFSRVRGGQEEEEEEDPLLRGFPDASSSSRRALPAPVRGSGEKGEGNGSVAA
AVSGGRGAPTREARGGGGGAVPAPAAAAVFLFRIQEETCRNFSVSSRVAEEKGDRAGWRV
KWAGWGAARREAAVGAHRGLLGLVVRFVPGGSSIRTFTPFYFLVEPVDTLSVRGSSVILN
CSAYSEPSPKIEWKKDGTLLNLVSDDRRQLLPDGSLFISSVVHSKHNKPDEGYYQCVATV
ESLGTIVSRTAKLTVAGLPRFASQPEPSSVYVGNSAVLNCEVNADLVPFVRWEQNKQPLL
LDDRVIKLPSGTLVISNATEGDGGLYRCMVESGGPPKYSEEAELKVLPDPGATSNLVFLK
QPSSLIRVIGQSAVLPCVASGLPTPSIRWVKNQETVDTESSGRLVLLAGGSLEIBDVTED
DAGTYFCIADNGNETIEAQAELTVQAQPEFLKQPTNIYAHESMDIVFECEVTGKPTPTVK
WVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQAGAQLIILEHDVA
IPTLPPTSLTSATTDHLAPATAGPLPSAPRDVVASLVSTRFIKLTWRTPASDPHGDNLTY
SVFYTKEGIARERVENTSRPGEMQVTIQNLMPATVYIFRVMAQNKHGPGESSAPLRVETQ
PEVQLPGPAPNIRACATSPTSITVTWETPLSGNGEIQNYKLYYMEKGTDKEQDVDVSSHS
HTINGLKKYTEYSFRVVAYNKHGPGVSTQDVAVRTFSDVPSAAPQNLSLEVRNSKSIVIH
WQPPPPAAQNGEITGYKVRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALT
VNGTGPATDWLSAETFESDLDETRVPEVPSSLHVRPLVTSIVVSWTPPENQNIVVRGYAI
GYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHTDT
SEVDLFVINAPYTPVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTV
RWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELV
PTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGN
RLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKASGSAGKGSRLPDLGSDYKP
PMSGSNSPHGSPTSPLDSNMLLVIIVSVGVITIVVVVIIAVFCTRRTTSHQKKKRAACKS
VNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSM
DSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQPVISAHPIHSLDNPHHH
FHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTESVRNTPSTDTMPASSSQTCCTDH
QDPEGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPTGPPTYDPALPSTPL
LSQQALNHHIHAVKTASIGTLGRSRPPMPVVVPSAPEVQETTRMLEDSESSYEPDELTKE
MAHLEGLMKDLNAITTA
NT seq 5274 nt   +upstreamnt  +downstreamnt
atggttttttctcaaaatattttccatgggtgcaacctgtacgattttcrgtattctcag
cagccgtgtaaggacaaactgctttctcctaagtttgggtggcctggttctacctcacga
ttactaagtggtttacaatcacaacctccagctcccggttcaccagcgaagagatgtgat
ttcctggtacgaaaacgcgaggtggcccgcaaacgcagaggtaaaaggtctcagttacag
cccgcggatcggcccaaagcgggtcatggggttccgcccaggcccccgcaccggctggtg
gagcggacaccggcacctttgtttgcgctccgcttccctggaccccggccgagagccgcg
ggtgggggcgcgggccccgcggacctggcactgtcccggggaagctcgcggcgagggcgg
cccggccgggaagctggaggtcagcggcggcgcggtgggccccctcccacgggagccgcg
ccaggtcccagcaagagccgggcgggatcgctattccagaggcrtctgggggaggtgagg
cgggcggcgaggagagaaggggtgtgtttctcccgggtgcgaggaggccaagaggaggag
gaggaggaggatccgcttctccggggtttccctgacgccagcagcagctctcggcgcgcg
ctccccgcgcccgtccgcggctccggggagaagggggaggggaatgggtccgtcgccgcg
gccgtgagcggcggccgcggggcgccgacccgggaggctcggggtgggggcgggggcgcg
gtaccggcaccggcggcggctgcggtgtttttgtttaggatccaggaggaaacgtgcagg
aacttctctgtctcgtctcgggttgcggaggagaaaggggatcgcgcagggtggagagtg
aagtgggcaggctggggcgccgccaggagagaggcggcggtgggggcgcatcgggggctc
ctgggtctagttgtgcgctttgtacccggaggatccagcattcggacattcactccattt
tactttttggtggaaccagtggatacactctcagttagaggctcttctgttatactaaac
tgttcagcatattctgagccatctccaaaaattgaatggaaaaaagatggaactctttta
aacttagtgtcagatgatcgacgccagcttctcccagatgggtctttgtttatcagcagt
gtggtgcattccaaacacaataaacctgatgaaggttattatcagtgtgtagccactgtt
gagagtcttggaactattgtcagcagaacggccaagctcacagtagcaggtcttccaaga
tttgccagccaaccagagccttcttcagtttacgttgggaacagtgcggttctgaattgt
gaagttaatgcagatttggtcccatttgtgagatgggaacagaacaaacagcctcttctt
ctggatgatagagttatcaaacttccaagcggaacgctagttatcagcaacgcaactgaa
ggagatgggggactctatcgatgcatggttgaaagtggagggccaccaaagtatagtgag
gaagctgaattaaaagttcttccagatcctggtgccacatcaaacttggtatttttgaaa
caaccttcttccttaatcagagtcattggtcagagtgcagtgttgccatgtgttgcttca
ggacttcctactccaagcattagatgggtgaaaaaccaggagacagttgacacagaaagc
tctggaaggttggtattgctggcaggtggtagtctggagatcratgatgtcaccgaggat
gatgctgggacttatttttgtatagcygataatggaaatgagaccattgaagctcaagca
gagcttacagtacaagcccaacctgaattcctgaagcagcctactaatatatatgctcat
gaatctatggatattgtgtttgaatgtgaagtcactggaaagccaactccaactgtgaag
tgggtcaagaatggggatatggttatcccaagtgattactttaagattgtaaaggaacat
aatcttcaagttttgggtctggtgaaatcagatgaagggttctatcaatgcattgctgaa
aatgatgttggaaatgcacaagctggagcccagctgataatccttgaacatgatgttgcc
atcccaacattacctcccacttcactgaccagtgccactactgaccatctagcaccagcc
acagctggaccactgccttcagccccacgggatgtcgtggcctccctggtctctacccgc
ttcatcaaactgacgtggcggacacctgcatccgatcctcatggggacaaccttacctac
tctgtcttctacaccaaggaggggattgctagggaacgtgttgagaataccagtcgccca
ggagaaatgcaggtgaccattcaaaacctaatgccagcaacagtgtacatctttagagtt
atggctcaaaataagcatggccctggagagagttcagctccactgcgggtagaaacacag
cctgaggttcagctccctggcccagcacctaacatccgagcctgtgcaacttcaccgact
tctatcactgtcacctgggaaacaccgttgtctggaaatggggaaattcagaattacaaa
ctgtactacatggaaaaggggactgataaagaacaggatgttgatgtttcgagtcactcc
cacaccattaacggattgaaaaaatacacggagtatagtttccgagtggtggcctacaat
aaacatggtcctggagtctccacacaagatgttgctgttcgaactttttcagatgttccc
agtgctgctcctcagaatctgtctttagaagtaagaaattcaaagagtattgtgattcac
tggcagccacctcctccagccgcacaaaatggagagatcactggctacaaggttcgctac
cgaaaggcttcccgaaagagtgatgtcactgagaccttggtgtctgggacacagctgtca
cagctgattgaaggtcttgatcggggaactgaatataatttccgagtggctgctctaaca
gtcaatggtacaggcccagctactgactggctgtcagctgaaacttttgaaagtgactta
gatgaaactcgtgttccagaagtgcctagttctcttcacgtccgcccactggtcactagc
atcgtagtaagctggacgcctccagagaatcaaaacattgtggtcagaggttatgccatt
ggttatggcattggcagccctcatgcccagaccataaaggtagactataaacaacgctat
tacaccatcgaaaatctggatcccagctctcactatgtgattaccctgaaagcatttaac
aacgtaggtgaaggcattcccttgtacgagagtgctgtgaccagacctcacacagacact
tctgaagttgatttgtttgttattaatgctccatacactccagtgccagatcccactccc
atgatgccaccagtgggagttcaggcttccattctgagccatgacaccataaggatcacc
tgggcggacaactccctgcccaaacaccagaagatcacagactcccgatactacacagtc
cgatggaaaaccaacatcccagcaaacaccaagtacaagaatgccaatgcaacgactttg
agttatttggtgactggtttaaaaccaaatacactctatgaattctctgtgatggtgacc
aaaggtcgaagatcaagcacatggagcatgacagcccacgggactacttttgaattagtt
cctacttctccgcccaaggatgtgacagttgtgagtaaagaggggaaacctaggaccata
attgtaaattggcagcctccctctgaagccaatggcaagattacaggttacatcatatat
tacagcacggatgtgaatgcagagatacatgactgggttatcgagcctgttgtgggaaac
aggctgactcaccagatacaggaattaacacttgacacaccatactacttcaaaatccaa
gcccggaactcaaagggcatggggcccatgtctgaagctgtccagttcagaacacccaaa
gcctcggggtctgcagggaaaggaagccgactgccagacctgggatccgactacaaacct
ccaatgagcggcagtaacagccctcatggaagccccacctctcctctggacagtaacatg
ctgctggtcatcatcgtttccgttggtgtcatcaccatcgtggtggtcgtgatcattgct
gttttctgcacccggcggactacctctcaccagaaaaagaaacgagctgcttgcaaatca
gtgaatggctcccacaagtataaagggaactccaaagatgtcaaacccccagacctctgg
atccatcacgagagactggagctcaaacccattgataagtctccagacccaaaccccatc
atgactgatacaccaattcctcgtaattctcaagatatcacaccagttgacaattccatg
gacagcaacatccatcaaaggcggaattcatatagagggcatgaatcagaggacagcatg
tctacactggcaggaaggcggggaatgagaccaaaaatgatgatgccctttgactcccag
ccaccccagcctgtgattagtgcccatcccatccattccctcgataaccctcaccatcat
ttccactccagcagcctcgcttctccagctcgcagtcatctctaccacccgggcagccca
tggcccattggcacatccatgtccctttcagacagggccaattccacagaatctgttcga
aacacccccagcactgacaccatgccagcctcctcgtctcaaacatgctgtaccgatcat
caggatcctgaaggtgctaccagctcttcttacttggccagctcccaagaggaagattcg
ggccagagtctccctacagcccacgttcgcccttcccacccactgaagagctttgctgtg
ccggcaatcccacccaccgggcctcccacctacgatccagcgttgccaagcacaccgtta
ctctcccagcaagctctgaatcatcacatccacgccgtgaagacggcctccatcgggact
ttaggaaggagccggcctcctatgccagtggtggttcccagtgcccctgaagtgcaggag
accacaaggatgctggaagactccgagagtagctatgaaccagatgagctgaccaaagag
atggcccacctggaaggactgatgaaggacctaaacgccatcacgacagcatga

DBGET integrated database retrieval system