KEGG   Bos indicus (zebu cattle): 109564649
Entry
109564649         CDS       T04792                                 

Gene name
F2R
Definition
(RefSeq) proteinase-activated receptor 1
  KO
K03914  coagulation factor II (thrombin) receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04024  cAMP signaling pathway
biu04072  Phospholipase D signaling pathway
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04610  Complement and coagulation cascades
biu04611  Platelet activation
biu04810  Regulation of actin cytoskeleton
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109564649 (F2R)
   04020 Calcium signaling pathway
    109564649 (F2R)
   04072 Phospholipase D signaling pathway
    109564649 (F2R)
   04024 cAMP signaling pathway
    109564649 (F2R)
   04151 PI3K-Akt signaling pathway
    109564649 (F2R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109564649 (F2R)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109564649 (F2R)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109564649 (F2R)
   04611 Platelet activation
    109564649 (F2R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109564649 (F2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109564649 (F2R)
G protein-coupled receptors [BR:biu04030]
 Rhodopsin family
  Peptide
   Thrombin
    109564649 (F2R)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 109564649
NCBI-ProteinID: XP_019823632
Position
10
AA seq 427 aa
MGPRWLLLWAAGLGLCSPLVSARTRGPRPGTDPTNGTLGPRSFFLRNSNDGYEQXPLPED
EDSSEGEFTEDRLSSGNRSSPPQKSPPGFISKSASGYLTSAWLTVFIPSVYTGVFLVSLP
LNIMAVVVFVLKMKVKKPAVVYMLHLAAADVLFVCVLPFKISYYFSGSDWRFGSAMCRFV
TAAFYGNMYASIMLMTAISVDRFLAVVYPIQSLSWRTLGRASFICLAIWAMAIAXVAPLL
LQEQATQVPGLNITACHDVLNQTLLEGYYSYYFSAFSAVFFFVPLTLSTVCYVSIIRCLS
SSTVANQNKKSRALLLSAAVFCIFILCFGPTNILLLLHYAFLSSDPMTEAAYFAYLLCVC
VSSISCCIDPLIYYYASSECQRHLFAILHCKESSDPGSCNSSGQLMPSKMDTCSSNLSSS
LYKKLLT
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggggccgcggtggctgctgctctgggccgcggggctcggtctgtgcagccccctggtg
tcggcccgcacccgaggccccagaccagggacagacccaacaaacggtactctgggtcct
cggtctttctttctcaggaattccaatgacggatatgaacaawtcccactgccagaggat
gaggactcgagtgaaggtgaattcacagaagacagattaagctcaggcaacagaagcagc
cckcctcaaaagtcaccccctgggtttatctccaaatccgcctcaggatatctgaccagc
gcctggctgactgtctttatcccctcagtctacacgggcgtgttcctcgtcagccttcct
ctgaacatcatggccgtcgtggtgttcgtcttgaagatgaaggtcaagaagccggccgtg
gtgtacatgctgcacctggccgcggcagacgtactcttcgtgtgtgtgcttccgttcaag
atcagctactacttctccggaagcgactggaggttcgggtctgccatgtgccgcttcgtc
acggcggccttctacgggaacatgtacgcctccatcatgctcatgacggccatcagcgtc
gaccgcttcctggccgtggtgtaccccatccagtccctctcctggcggaccctggggcgc
gcttccttcatctgcctggccatctgggccatggccatcgcnngggtggcgcccctgctc
ctgcaggagcaggccacccaggtgccggggctcaacatcaccgcctgccacgacgtgctc
aaccagacgctgctggaaggctactactcgtactacttctccgccttctccgccgtcttc
ttcttcgtgccgctgaccctttccaccgtctgttacgtgtccatcatccgatgcctcagc
tcttccacggttgccaaccagaacaagaagtcccgggctttgctcctgtccgcggctgtc
ttctgcatcttcatcctttgctttggacccacaaacatccttctgcttctccactacgcg
ttcctttcctctgatcccatgacagaggccgcctactttgcctacctcctgtgtgtctgc
gtcagcagcataagctgttgcatcgaccccttgatatactactatgcttcctcggagtgc
cagaggcacctctttgctatcttacactgcaaagaaagttcagatcccggcagctgtaac
agcagcggtcagctgatgccaagtaaaatggacacctgctctagtaacctgagtagcagt
ctatacaaaaagctcttaacttag

DBGET integrated database retrieval system