KEGG   Bos indicus (zebu cattle): 109564754
Entry
109564754         CDS       T04792                                 

Gene name
CD276
Definition
(RefSeq) CD276 antigen
  KO
K06746  immune costimulatory protein B7-H3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109564754 (CD276)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109564754 (CD276)
CD molecules [BR:biu04090]
 Proteins
  109564754 (CD276)
SSDB
Motif
Pfam: Ig_3 ig Ig_2 I-set V-set C2-set_2 C1-set
Other DBs
NCBI-GeneID: 109564754
NCBI-ProteinID: XP_019823809
Position
10
AA seq 533 aa
MLCGPSSTGVSVAPALGVLWFCLTGAAVEVQVPEDPVVALVGTDATLRCSFSTEPGFSLA
QLNLIWQLTDTKQLVHSFAEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFT
CFVRIRDFGSATVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPKAEVLWQDG
QGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITPHR
SPTGAVEVQVPEDPVVALVGTDATLRCSFSTEPGFSLAQLNLIWQLTDTKQLVHSFAEGR
DQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYS
KPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVLWQDGQGAPLTGNVTTSQMANEQGLFD
VHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSICLVALL
VALAFVCWRKIKQSCEEENAGAEDHDGDGEGSKTALRPLKHSENKEDDGPEIV
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgctgtgtggaccgagcagcacgggtgtgagtgtggcccccgccctgggagtgctgtgg
ttctgcctcacaggggccgcggtggaagttcaggttccggaagaccccgtggtggccctc
gtgggcaccgacgccaccctacgctgctccttctcgaccgagcccggcttcagcctggca
cagctcaacctcatctggcagctgacagacaccaaacagctggtgcacagcttcgccgag
ggccgcgaccagggcagcgcctatgccaaccgcacagcgctcttcccagacctgctggct
cagggcaatgcgtccctgaggctacagcgcgtgcgcgtggctgatgagggcagctttacc
tgcttcgtgagaatccgggacttcggcagcgccacggtcagcctgcaggtggcagccccc
tactcaaaacccagcatgaccctggagcccaacaaggacctgaggcctggggacacggtg
accatcacgtgctccagctaccggggctaccccaaggccgaagtgttgtggcaggatggg
cagggtgcgcccttgaccggcaacgtgaccacgtcgcagatggccaacgaacagggcttg
ttcgacgtgcacagtgtgctgagggtggtgctgggcgctaatggtacctacagctgcctg
gtgcgcaaccccgtgctgcagcaggacgcccacggctcggtcaccatcacgccccataga
agccccacaggtgcagtggaagtccaggttccggaagaccccgtggtggccctcgtgggc
accgacgccaccctacgctgctccttctcgaccgagcccggcttcagcctggcacagctc
aacctcatctggcagctgacagacaccaaacagctggtgcacagcttcgccgagggccgc
gaccagggcagcgcctatgccaaccgcacagcgctcttcccagacctgctggctcagggc
aacgcgtccctgaggctacagcgcgtgcgcgtggctgatgaggggagcttcacctgcttc
gtgagcatccgggacttcggcagcgccgcggtcagcctgcaggtggcagccccctactca
aaacccagcatgaccctggagcccaacaaggacctgaggcctggggacacggtgaccatc
acgtgctccagctaccggggctaccccgaggccgaagtgttgtggcaggatgggcagggt
gcgcccttgaccggcaacgtgaccacgtcgcagatggccaacgaacagggcttgttcgac
gtgcacagtgtgctgagggtggtgctgggcgctaatggtacctacagctgcctggtgcgc
aaccccgtgctgcagcaggacgcccacggctcggtcaccatcacaggacagcccatgaca
ttcccccccgaggccctgtgggtgaccgtggggctctccatctgccttgtcgcactgctg
gtggccctggccttcgtgtgctggagaaagatcaaacagagctgcgaggaggagaatgca
ggagccgaggaccacgatggggatggagaaggatccaagacggccctgcggcccctgaaa
cactctgaaaacaaagaagatgatggaccagaaatagtctga

DBGET integrated database retrieval system