KEGG   Bos indicus (zebu cattle): 109564883
Entry
109564883         CDS       T04792                                 

Gene name
PARP2
Definition
(RefSeq) LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 2
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03410  Base excision repair
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    109564883 (PARP2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109564883 (PARP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:biu03032]
    109564883 (PARP2)
   03036 Chromosome and associated proteins [BR:biu03036]
    109564883 (PARP2)
   03400 DNA repair and recombination proteins [BR:biu03400]
    109564883 (PARP2)
Enzymes [BR:biu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     109564883 (PARP2)
DNA replication proteins [BR:biu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109564883 (PARP2)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    109564883 (PARP2)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     109564883 (PARP2)
SSDB
Motif
Pfam: PARP PARP_reg WGR
Other DBs
NCBI-GeneID: 109564883
NCBI-ProteinID: XP_019824012
Position
10
AA seq 562 aa
MAARRRGTAGGRARAERVNNGKTVAEDPPPAKKIRKCHRLKKEPVAEGKTDSDRTEDKQE
SVKTLLLKGKAPVDPECTTKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDA
QRNFSVWMRWGRVGKTGQHSLVACSGDLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKY
DMLQMDYASNTQNEEEXKKEESLKSPLKLESQLDLRVQELIKLICNVQAMEEMMVEMKYD
TKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALMEACNEFYTRIPHDFGLRTPPLI
RTEKELSDKVQLLEALGDIEIAIKLVKTELQSPEHPLDQQYRKLRCALHPLXHESYEFKV
ISQYLQSTHAPTHSDYTMTLLDVFEVEKEGEKEAFREDLHNRMLLWHGSRLSNWVGILSH
GLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFATRLKDTGLLLLSEVALGQCNELLGA
NPEAEGLLQGKHSTKGLGKMAPSPACAITLNGSTVPLGPASDTGILNPEGYTLNYNEFIV
YNPNQVRMRYLLKVQFNFLQLW
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggcagctcggcggcgggggactgcggggggcagagcgcgagctgaaagagttaataat
ggcaaaacagttgcagaagaccctcctcctgcaaagaaaattcgaaaatgtcacaggctg
aaaaaggagcctgtggctgaaggaaagacagatagtgacaggactgaagacaagcaagag
tctgtgaagaccttgctgttaaagggcaaagctccagtggacccagagtgcacaaccaag
gtrgggaaggcccatgtgtactgtgaaggaaatgatgtctatgatgtcatgctaaatcag
accaatctccagttcaacaacaacaagtattacctgattcagctgttagaagatgatgcc
cagagaaacttcagtgtttggatgagatggggccgagttgggaagacagggcagcacagc
ttggtggcttgttccggggacctcaacaaggccaaggaaatctttcaaaagaaattcctt
gacaaaacaaaaaataattgggaggatcgtgagaagtttgagaaggtgcctggaaaatat
gatatgctacaaatggactatgccagcaatacacagaatgaagaggaaasaaagaaagag
gaatctcttaaatcccccttgaaactagagtcacagctagatcttcgtgtacaggagctg
ataaagttgatctgtaatgtccaggccatggaagaaatgatggtagaaatgaaatatgat
accaagaaagctccacttgggaagctgacagtggcacaaatcaaggcaggttaccagtct
cttaagaagattgaggattgtattcgggctggccagcatggacgagctctcatggaagca
tgcaatgaattctacaccagaatcccacatgactttggactccgtacccctccattaatc
cggacagagaaagaactgtcagataaagtacaactactggaggctttgggagacattgaa
attgcaattaagctggtgaagacagaactgcaaagcccggaacacccattggaccaacag
tatagaaaactacggtgtgccttgcaccctttasaccatgagagttatgagttcaaagtg
atttcccagtacctacagtctacccatgctcccacacacagtgactataccatgaccttg
ctggatgtctttgaagttgagaaggagggtgaaaaagaagccttcagagaggaccttcat
aacaggatgctactctggcatggctccaggctgagtaactgggtaggaatcctaagccat
gggcttcgaatcgccccacctgaggctcccatcacaggttacatgttcggaaaaggaatc
tattttgctgacatgtcttccaagagtgccaattactgctttgccactcgcctaaaggat
actgggctgctgctcttatcagaggtagctctgggtcagtgtaatgagctgctcggggcc
aatccagaggcagagggattacttcaaggcaaacacagcaccaaggggctgggcaagatg
gctcccagtcctgcgtgcgccatcaccttgaatgggagtacagtgccattaggaccagca
agtgacacaggaattctgaatccrgagggctataccctcaactacaatgaatttatcgtc
tataaccctaaccaggtccgtatgcgataccttctaaaggttcagtttaatttcctgcag
ctgtggtga

KEGG   Bos indicus (zebu cattle): 109567055
Entry
109567055         CDS       T04792                                 

Gene name
PARP4
Definition
(RefSeq) poly [ADP-ribose] polymerase 4
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03410  Base excision repair
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    109567055 (PARP4)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109567055 (PARP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:biu03032]
    109567055 (PARP4)
   03036 Chromosome and associated proteins [BR:biu03036]
    109567055 (PARP4)
   03400 DNA repair and recombination proteins [BR:biu03400]
    109567055 (PARP4)
Enzymes [BR:biu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     109567055 (PARP4)
DNA replication proteins [BR:biu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109567055 (PARP4)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    109567055 (PARP4)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     109567055 (PARP4)
SSDB
Motif
Pfam: VIT PARP VIT_2 VWA_3 VWA BRCT BRCT_2 VWA_2 Drf_FH1 PARP_reg PTCB-BRCT VWA_CoxE LIG3_BRCT
Other DBs
NCBI-GeneID: 109567055
NCBI-ProteinID: XP_019827372
Position
12
AA seq 1821 aa
MTVGIFANCTFCLKAKHLTRQQKRKLQTDIKENGGNFSFLLNAQCTHVILDNADVLSQYQ
LKSIQKNHILIANPDFVWESIKERRLLDTKIYGPSESLDITSASSEEWSSPKMEMNDSSF
LDSSTEKENTVELTKFYAEGVEIPHFPQDFEVAKYNILEKVVTEGGKETAVVELQCLQGP
GDRGFLICTHFLLATGTQTRRQSSVKKTSADASEYYENYIEELKKQGFLLREHFTPEATQ
LASEKLQALLLEEVINSNALSPEVSGLVEMLWAEALGRLEDTLLRPVGMMSLNDVSKAEG
ILLLVKEAMRNGETQEQLQMMLTEFYRLIPHRAAVAEKVSLSLLAKKEDLCQLIRDMVNV
CETNLAKPNPPSLAKYRALRCKIEHVEPNTEEFLRVREEVLQNNHSKGPVDILQIFRVGR
VSETTEFQGHLGNVRHLLHGSPVQSFMGILSRGLLLPKVVEDRGMKRTDIGNLGSGIYFS
DSISTSIKYSHPGQTDGARLLVVCDVALGRCMDLHKRDFSLTEAPPEYDSVHGVRGTDMV
SSDFEDDEFVVYKTNQVKMKYLVKFSVPGDEIKDFHPCDNTELEEDRPEFSNFSAVEDHQ
LPGSTPFPDIKAGLQDASGNSVPLEDVHIKGKIIDFVAQVIVFQTYTNQSHVPIEAKYVF
PLDDKAAVCGFEAFINGKHVVGEIKEKEVAQREYRVAISQGHGAYLMDQDTPDIFTVSVG
NLPPKAKVLVKITYITELSIQGACAVFFLPATVAPWQQDRALRENLQDTVEKICIKEIGA
KQSFSLSMSIEMPHMIEFISSDTHBLRKKRTDCKAVISTVEGSSLDSNGFSLLIGLVDVY
LPRMWVEKHPEKESEACMLVFQPNLGITVPDEAERSEVIICLDCSNSMEGETFLQAKQIA
LHALSCVGKEQKVNVIKFGTSYKELFSYPKCITSNKMPTEFIMSATPTMGNTDFWKTLRY
LNLLYPSHVLRNILLISDGHLQNESLTLQLVRRSVPHTRLFSCGVSSTANRHVLRSLSHY
GAGVFEYFNSKSKHSWKKQIEAQMDRLSSPSCHSVSVKWQQLSTDTPAPLQAPTQVQSLF
HSERLLVYGLTPHCTQATLHALIQEREYSTVVSTTELQKTTGTMIHKLAARALIRDYEDG
ILHENEVNHEMKKQTLKSLIIKLSKENSLITQFTSFVAVEKRYGNESPSPDIPNTLELIA
KEDIDFLPYMSWEGEQPDASRMQTLSASSEWNQEPKRKCKRKQTKKKRSSLKMILSEDFK
AFSSDAPEESEAVSFVFRDAEEPWGLGLMESSKQTEVKPQFTEAISQKTAXSDIPTAPSF
LTTPLHVGSGFYLQASSALFGSPAGPKHFGSPKKYLEMGSGADVSLDMASFPRLHLQGSP
LQLAAAPRVSFSSRSQLPKTNQGGATGFSALTTLQXDPLSRPNLFSCSASLLPCPLVKSV
FSSPASPPSLPRGVVPPPPPLPGWCGVLPSPPLPPLTGGLVPPPPPLSQRVGIPPPPPPP
LPGWCGVPPSPPLPPLTGGLVPPPPPLPGWXGVPPPPHLPPSIWRNCTPSSPSISGGGHS
SSPSSPSFLSSSLYKLPVAPSGPAEDARLDIPLLAVYDKPLSLDSLQYDCSFFECSSETE
SDKTGELLASRIFKKLAEYDLRSGFTASTQAQKDEDGLVGKASWRNYVPSTELFRLQTKD
GCWKLTQELGFILKLNTNILNSFLEQKGIRSLGVRGRERLLDLIATFLVLQFLRTKLEQE
GIIVKSLMRLDDASIPRNIPWDCEKIKKASEWLRRTEGQYPSICQRLELGKDWDSATKQL
LGILPRDAASPPHRLLKHSQG
NT seq 5466 nt   +upstreamnt  +downstreamnt
atgactgtgggaatcttcgcaaactgtaccttctgtttgaaagccaagcacttaactcgt
caacagaagagaaaactacaaactgatattaaggaaaatggtggaaatttttccttttta
ttaaatgctcagtgcacacatgtaatcttagacaatgctgatgttctgagccagtatcag
ctgaagtctattcagaagaaccatattcttattgcaaacccagattttgtatgggaatct
atcaaagaaagaagactgctggatacaaagatttatggtcccagtgagtcactggacatc
acatcagcttccagtgaagaatggagcagccctaaaatggaaatgaatgattcttcattc
ctggacagttccacagagaaggagaacactgttgaactcactaagttttatgcagagggt
gttgaaattcctcattttcctcaagattttgaagttgcaaaatataacatcttggaaaaa
gttgtgacagagggaggtaaggagaccgcsgtggtggagctgcagtgcctccagggccct
ggggaccgtggctttctgatatgcacacacttcctcctggccactggcacccagaccaga
aggcagtcctctgtgaagaaaacctctgcagacgcaagtgaatactatgagaattatatt
gaggaactgaagaaacaaggctttctactgagagaacattttacacctgaagcaacccag
ttagcatctgaaaaactgcaagcattgcttttggaggaggtaataaactcgaatgccctg
agccccgaggtgagcggcttggtggagatgctctgggcagaagccctcggccgcctggag
gacacactgctgagacctgtgggcatgatgagcctgaatgacgtgagcaaggcagaggga
attctcctcctggtaaaggaagcaatgagaaatggagaaacacaggagcaactgcaaatg
atgctgaccgagttctacagattaatccctcacagagctgctgtggccgagaaggtcagc
ctgagcctgctggctaagaaggaggacctgtgccagctaataagagacatggttaatgtc
tgtgaaactaatttggccaaacccaaccccccrtctcttgccaaataccgagctttgaga
tgcaaaattgagcatgttgagccgaacactgaagaatttttgagagtaagagaagaagtg
ttgcagaataatcacagtaagggtccagtggacatcttgcagatatttagagttggcaga
gtgagtgaaaccacagagttccagggccaccttggcaatgtcaggcacttgctgcatggg
tctcctgtgcagagcttcatgggaatcctgtcccgtgggttgcttttacccaaagtagtt
gaagatcgtggcatgaagagaacagacattggaaatcttgggagtgggatatatttcagc
gattcaatcagtacaagcatcaagtactcgcaccctggacagacagatggcgcccgactc
ctggtcgtctgtgatgtcgcactcggcaggtgcatggacctgcacaagcgagacttctcc
ctgacggaggcaccacccgagtacgacagcgtccacggggtgcggggaacggatatggtc
agctcggactttgaggatgatgaatttgttgtatacaaaaccaatcaggttaaaatgaaa
tatcttgttaaattttctgtacctggagatgaaataaaggactttcatccttgtgacaat
acggaactagaggaagacagacctgagttttcaaatttttcagcagttgaagatcaccag
cttccaggcagcacgcctttccccgacatcaaggccggcctccaggatgcctctgggaat
tcagttcctctggaggacgttcacatcaaggggaaaataatagactttgtagcccaggtc
attgtttttcaaacatacacaaaccaaagtcatgtgcccattgaggcaaaatatgttttt
cctttggacgacaaggcagctgtatgtggtttcgaggctttcatcaatgggaagcacgtg
gtgggagagattaaagagaaggaagtggcccagcgagagtaccgagtggcgatcagtcaa
ggtcatggcgcctacctgatggatcaggacacacccgacatcttcaccgtcagcgtcggg
aacttacccccaaaggccaaagtcctggtcaaaatcacctacatcacggagctgagcatc
cagggtgcctgcgcggtcttcttcctgccggccacggtggcgccctggcagcaggacagg
gctctgagggagaaccttcaggatacagtggagaagatttgtataaaggaaataggagca
aagcaaagcttttctctgagcatgtctatcgagatgccgcacatgattgaattcatctcc
agtgacacacacracctgagaaaaaagagaacagactgcaaagctgtgattagtactgtg
gaaggcagctccttagacagcaatggattttctctcctcatcggtttggttgatgtgtat
ctcccaagaatgtgggttgaaaagcatccagaaaaagaaagcgaggcctgcatgcttgtg
tttcaaccaaatcttggtattaccgtccctgacgaagctgagaggagtgaagtgattatt
tgtcttgattgctccaattccatggagggcgagacattcctgcaagccaaacagattgcc
ttgcatgcactgtcctgtgtgggaaaggagcagaaggtgaacgtcatcaagttcggcaca
agttacaaggaattattttcatatcctaagtgcatcacgagcaataagatgccgacagag
ttcatcatgtctgctacacctaccatgggaaacacagatttctggaagacacttcgatac
ttaaatttgctgtacccttcccacgtgttacggaacatcctcctcatatccgacgggcac
ctccagaacgagagcctgaccttgcagctcgtaagaagaagcgtgccgcacaccaggctg
ttctcctgtggggtcagttctacagcaaatcgtcatgtcttacggagtctgtcccactat
ggcgctggagtatttgaatattttaactcaaaatccaaacatagctggaaaaaacagata
gaagcccagatggataggctgagttctcccagttgccactcggtctccgtcaaatggcag
cagctgagcacggacacgcccgcacccctgcaggcccccacccaggtgcagtccctgttc
cacagcgagcgactccttgtctacgggctcactcctcactgtacacaggcaactctacat
gcgctgattcaagagagagagtattctacagtggtgtcaactactgaacttcagaagaca
actggaacgatgattcacaagctggcagctcgagctctgataagagattatgaagatggc
attctccacgaaaacgaagtgaatcacgagatgaagaagcaaactttaaaatctctgatt
attaaactcagtaaagaaaactctctcataacacagtttacaagctttgtggctgtggag
aaaaggtatggtaatgagtcaccttctcctgatattccaaatactttggaacttattgcc
aaagaagacatagattttctgccatacatgagctgggagggggaacaaccagatgccagc
aggatgcagacactttcagcatcgtctgaatggaaccaagaacccaaacgtaaatgtaaa
cgtaaacagactaaaaagaagcgttcatcacttaagatgatactttctgaagattttaaa
gcctttagctcagatgccccagaagaatctgaagcggtcagttttgtcttcagggatgca
gaggagccctggggtttgggtctgatggagtcatctaaacaaacagaagttaaaccacaa
ttcacagaagctatctcacagaaaacggccktttctgacattcctactgcccctagtttc
ttaactacacccctccatgttggctctggtttctaccttcaggccagttcagcactgttt
ggttctccagctggtcccaaacacttcggttcccctaagaagtacctggaaatgggcagt
ggtgccgacgtttccctggacatggcgtcttttcccaggctgcatctccaggggtcacct
ttgcaacttgctgctgctcccagggtctcgtttagctccaggtctcagctgcccaaaacc
aatcaagggggtgccacaggcttcagtgccctcactacccttcagcmagaccctctctca
cggccgaatcttttttcctgttctgcaagtcttctcccttgtccacttgtaaagtctgtc
ttttcttcccctgcctctcctccctccctacccaggggcgttgttccccctcctccccct
ctacctgggtggtgtggtgttcttccttctccccctcttccccctctaactgggggactt
gttccccctcctccccctctatctcagagggttggcattcctcctccccctcctccccct
ctacctgggtggtgtggtgttcctccttctcccccacttccccctctaactgggggactt
gttccccctcctccccctctacctgggtggrgtggtgttcctcctcctccccatcttccc
ccctctatctggaggaattgcaccccctcctccccctctatctcagggggtgggcattcc
tcctccccctcctccccctctttcctctcctcttccctttataagctgccagtggctcca
tctggccctgctgaggatgcccggctggacattcctctgttagctgtgtatgataaacct
ttgtcattagactccctccaatatgactgttcattttttgaatgttcttctgaaacggaa
agtgataaaacaggagaacttctggcaagtaggatttttaaaaagctggcagaatatgac
ctgagaagtggctttactgcaagtactcaggcacaaaaagatgaggatggcctagttggc
aaagcaagctggaggaattatgtgccttcgactgaactcttcaggcttcagaccaaggat
ggatgctggaaacttacacaagaactgggatttatattaaaacttaatacaaatatttta
aacagctttcttgagcaaaaaggcattcgatctttaggtgtaagaggaagagagcgcctt
ctagatctgatcgccacgtttctagtgctgcagttccttcgcaccaagttggaacaggag
ggaataatcgtcaaatcgctgatgagactggatgatgcttccattcccaggaatattccc
tgggattgcgagaaaataaagaaagccagtgagtggctcagaagaactgaagggcagtac
ccatccatctgccagcggctggagctgggtaaagactgggactccgccaccaagcagctg
ctgggtatcctgcccagagatgccgcctcccctcctcacaggctccttaagcacagccaa
ggctga

KEGG   Bos indicus (zebu cattle): 109570525
Entry
109570525         CDS       T04792                                 

Gene name
PARP1
Definition
(RefSeq) poly [ADP-ribose] polymerase 1 isoform X1
  KO
K24070  poly [ADP-ribose] polymerase 1 [EC:2.4.2.30]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03410  Base excision repair
biu04064  NF-kappa B signaling pathway
biu04210  Apoptosis
biu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    109570525 (PARP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109570525 (PARP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109570525 (PARP1)
   04217 Necroptosis
    109570525 (PARP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:biu03032]
    109570525 (PARP1)
   03036 Chromosome and associated proteins [BR:biu03036]
    109570525 (PARP1)
   03400 DNA repair and recombination proteins [BR:biu03400]
    109570525 (PARP1)
Enzymes [BR:biu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     109570525 (PARP1)
DNA replication proteins [BR:biu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109570525 (PARP1)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    109570525 (PARP1)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     109570525 (PARP1)
SSDB
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2 DUF948
Other DBs
NCBI-GeneID: 109570525
NCBI-ProteinID: XP_019832104
Position
16
AA seq 1016 aa
MAESSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVQSPMFDGKIPHWYHLSCFWKV
GFSIWHPDVEVEGFSELRWDDQQTIKKMAETGGATDVSGKGQDGVGSKTEKTLIDFGAGY
AKSNRSTCKSCMEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFS
ASQLMGFSVLTAEDQETLKKQLPAIKGERKRKGDEVDGIDEVTKKKSKKEKDKEIKLEKA
LKAQNDLIWNVKDELKKACSTNDLKELLIFNKQEVPSGESAILDRVADGMVFGALLPCEE
CSGQLVFKGDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYFKKLKIKKQDRIF
PPESSTPVGAAAPPSAASAPAAVHSGPPDXPLSNMKILTLGKLSQNKDEVKATIEKLGGK
LTGTANKASLCISTKKEVDKMNKKMEEVKEANIRVVSEDFLQDISASTKSLQELLSTHLL
SPWGAEVKVEPVEAVAPKGKSGAAPSKKSKGPVKEEGTNKSEKRMKLTLKGGAAVDPDSG
LEHNAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVGTVIGS
NKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKHPKKFYPLEIDYGQDEEAVKKLTVN
PGTKSKLPKPVQNLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQ
ALSQGSSDSHILDLSNRFYTLIPHDFGMKKPPLLNNANSVQAKVEMLDNLLDIEVAYSLL
RGGSDDSSKDPIDVNYEKLKTDIKVVDKDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFK
IEREGESQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFA
DMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDP
SASITVDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFKTSLW
NT seq 3051 nt   +upstreamnt  +downstreamnt
atggcggagtcttcagacaagctctaccgggtcgagtacgccaagagcgggcgcgcgtct
tgcaagaaatgcaaagagagcatccccaaggactcgatccggatggccttcatggtgcag
tcgcccatgttcgatgggaaaatcccgcactggtaccacctctcctgyttctggaaggtc
ggcttctccatctggcaccctgatgtcgaggtggaggggttctctgagctccgctgggat
gaccagcagacgatcaagaagatggccgagactggcggagcgacagatgtttcaggcaaa
ggccaagatggagttggcagcaagaccgagaagacactgattgactttggggcagggtac
gccaagtccaacagaagcacgtgcaagagctgcatggagaagatagacaagggccaggtg
cgcctgtctaaaaaggtggtgtaccccgataagccccagytgggcatggttgactgctgg
taccacccaaagtgttttgttcagaaacgggaggagctgggcttccgtcccgagttcagc
gcaagccagctcatgggcttcagcgtcctcaccgcagaggaccaagaaaccctcaagaag
cagctcccggccatcaagggtgaaagaaagagaaaaggtgatgaggtggatggaatagat
gaagtgaccaagaagaaatctaaaaaagaaaaagacaaggagattaaacttgaaaaggcc
cttaaggcccagaacgacctgatctggaatgtcaaggacgagctaaagaaagcgtgctct
acgaacgacctgaaagaactgctcatcttcaacaagcaggaagtgccctccggggagtcg
gcgatcttggaccgmgtggccgacggtatggtgtttggcgccctccttccctgcgaggaa
tgctcgggccagctggtcttcaagggcgacgcctattactgtaccggggatgtgactgcc
tggaccaagtgtatggtcaagacacagacgcccaaccggaaggagtgggtgaccccaaag
gaattccgagaaatctcttacttcaagaaactgaagatcaaaaagcaggaccgtatattc
cccccagagagcagcaccccggtgggggcagcagccccaccctctgcagcttcagcgcct
gccgctgtgcactctggccccccagacmagccattatccaacatgaagatcctgactctc
gggaaactctcccagaacaaggatgaagtgaaggccacgattgagaaactcggggggaaa
ttgacagggacggccaacaaggcctccctgtgtatcagcaccaaaaaggaggtggacaag
atgaataaaaagatggaggaagtaaaagaagccaacatccgtgtcgtgtctgaggacttc
ctccaagacatctccgcctccaccaagagccttcaggagttgctctccacccacctcttg
tccccctggggagccgaggtgaaggtggagcctgttgaagcagtggccccaaaggggaag
tcgggggccgcgccctccaagaagagcaagggtcccgtcaaggaggaaggtaccaacaaa
tctgaaaagaggatgaaattaactcttaaaggaggagcagctgtcgaccctgattcaggt
ctggaacacaatgcacacgtcctcgagaaaggcgggaaggtcttcagcgccaccctcggg
ctcgtggacatcgtcaaagggaccaactcctattacaagctgcagctcctggaggatgac
aaagagagcaggtactggatattcaggtcctggggccgtgtgggcacggtgattggtagt
aacaaactggagcagatgccatccaaggaggatgccattgagcattttatgaaattatat
gaagagaaaaccggaaacgcctggcactctaaaaactttacgaagcatcccaaaaagttc
taccctctggagattgactatggccaggatgaagaggcggtgaagaagttgacagtaaac
cctggcaccaagtccaagctccccaagccagtgcagaacctcattaagatgatctttgat
gtagagagtatgaagaaagccatggtggagtatgagattgaccttcagaagatgcccttg
gggaagctgagcaaaaggcagatccaggctgcatactccatcctcagtgaggtccagcag
gcactgtcccagggcagcagtgactctcacatcctggatctctccaaccgcttctacacc
ctgatcccccacgacttcgggatgaagaagcccccgctgctgaacaacgcaaacagcgtg
caggccaaggtggaaatgctagacaacctgctggatattgaggtggcctacagtctactc
aggggtggttctgatgacagcagcaaggaccccattgatgtcaactatgagaagctcaaa
actgacattaaggttgtggacaaagattccgaagaagccgagatcattaggaagtatgtg
aagaacactcacgcgaccacacacaacgcgtacgacttagaagtcgtcgacatcttcaag
atagagcgcgaaggggaaagccagcgttacaagccgtttaagcagctgcataaccggagg
ctgctgtggcacgggtccaggaccaccaacttcgcgggcatcctgtcccagggtctccgg
atagccccacctgaagcacctgtgacgggctacatgtttggtaagggaatctatttcgcc
gacatggtctccaagagtgccaactactgccacacgtcccagggagacccaataggcttg
atcctgttgggagaagttgcccttggaaacatgtatgaactgaaacatgcttcgcatatc
agcaagttacccaagggcaagcacagtgtcaaaggtttaggcaaaactacccctgaccca
tcggctagtattactgtggatggtgtggaggtgcctctcgggacagggatttcatctggt
gttaatgacacctgtctgctgtataacgagtacatcgtctacgacattgctcaggtccac
ctgaagtacctgctgaagctgaagttcaactttaagacatccctgtggtga

KEGG   Bos indicus (zebu cattle): 109575871
Entry
109575871         CDS       T04792                                 

Gene name
PARP3
Definition
(RefSeq) LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 3
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03410  Base excision repair
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    109575871 (PARP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109575871 (PARP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:biu03032]
    109575871 (PARP3)
   03036 Chromosome and associated proteins [BR:biu03036]
    109575871 (PARP3)
   03400 DNA repair and recombination proteins [BR:biu03400]
    109575871 (PARP3)
Enzymes [BR:biu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     109575871 (PARP3)
DNA replication proteins [BR:biu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109575871 (PARP3)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    109575871 (PARP3)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     109575871 (PARP3)
SSDB
Motif
Pfam: PARP_reg PARP WGR Ni_hydr_CYTB
Other DBs
NCBI-GeneID: 109575871
NCBI-ProteinID: XP_019839678
Position
22
AA seq 613 aa
MLPTTVVRTDCLGGTDPVATTSPRSLLLLAEVTQPSNHARSKSAERGEEQRVLCKEEPRS
GKGTATVPKHKLQVQHEGPEKTKGXQGAEEEDSFRSTAEALKAAPTEKCIAGVDPSCPLS
CNPGTQPWGARASLPSLYPLWPRVHEDYNCTLNQTNIERNNKFYIIQLLKDADCFFCWTY
WGRVGEVGQSKLSRFKSLEDAKKSFEKKFRDKTKNSWAERDHFVAQPGKYTLTEVQREDE
AQEVVEKVDGGPVKAVVQRVRPCSLDAATQKLITNIFSKDVFQNAMALMNLDVKKMPLGK
LSKQQIAXGFEALEEVEAALKAPADSGRSLEELSSHFYTIIPHNFGRSRPPPINSPELLQ
AKKDMLLVLADIELAQTLQAAPEETKKVEEVPHPLDRDYQLLKCQLQLLGPETPEYKVVH
AYLKQTSNSDRPPALQHVXKVDREGEGDRFQVHAKLGNRKLLWHGTNVAVVAAILTSGLR
IMPHSGGRVGNGIYFSSENHKSAGCVIGISCGAHHIGYMFLGEVALGREYHITVDEPRLK
QPPSGFDSVIARGHTEPDPTRDTELELDGQRVVVPQGQPVLCPDFRSCNFSQSEYLIYQE
SQRCLRYLLEIHL
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgctgcccacgacggttgttagaactgactgcctaggaggwactgacccggtggccacc
acttctcccaggtccctgcttctcttagctgaggtgacacagcccagcaaccatgccagg
tccaagtcagctgagaggggggaggaacagagagtgctctgcaaggaggagcccagaagt
gggaagggaacagccacggttccaaagcacaagctccaagtgcagcatgagggtcctgag
aagacgaaggggcracagggggcagaagaagaggacagtttccgttccactgctgaggcc
cttaaggccgcgcccacagagaagtgcatagccggagtggacccctcatgtccactcagc
tgcaaccctggaacccagccctggggtgcccgagccagcctgccctccctgtacccgctc
tggccacgggtgcatgaagactacaactgcaccctgaaccaaaccaacattgagagaaac
aacaagttctacatcatccagctgctgaaagatgctgactgcttcttctgctggacctac
tggggacgcgtgggagaggtgggccagtcaaagctcagccgcttcaagtcactggaggat
gcaaagaagagttttgagaagaaatttcgggacaagaccaagaacagctgggcagagcgg
gaccactttgtggcccagcccggcaagtatacacttaccgaggtgcagagagaggacgag
gcccaggaagtcgtggagaaggtggacggaggcccagtgaaggctgtggttcagcgggtg
cggccctgctccttggacgcagctacgcagaagctcatcaccaacatcttcagcaaggac
gtgttccagaacgccatggccctcatgaacctggatgtgaagaagatgccactagggaag
ttgagcaagcagcagatcgccncgggtttcgaggccttggaggaagtggaggcggccttg
aaagcccccgcagacagtgggcgcagcctggaggagctgtcctcccacttctacaccatc
attccccacaacttcggccgcagccggcccccacccatcaactcccctgagcttctgcag
gccaagaaggacatgttgctggtcctggcggacatcgagctggcccagaccctgcaggcc
gcccccgaggagacaaagaaagtggaggaagtgccacacccactggaccgagattaccag
ctcctcaagtgccagctccagctgttgggcccagagacccctgagtacaaggtggtacat
gcctacttaaaacagactagcaacagcgacaggccccctgctcttcaacatgtttagaag
gtggaccgagaaggggagggagatcggttccaggtccatgccaagctgggcaatcggaag
ctactgtggcatggcaccaacgtggccgtggtggccgccatcctcaccagtgggctccgc
attatgccacattctggaggccgggtcggcaatggcatctacttctcctcagagaaccac
aagtcggctggctgtgttattggcatatcctgcggggcccatcacattggctacatgttc
ctgggtgaggtggcactgggcagagagtaccacatcaccgtcgacgagcccagattgaag
cagccaccctctggcttcgacagtgtsattgctcgtggccacacagagcctgatccaacc
cgggacaccgagctggagctagatggccagcgagtagtggtgccccagggccagcccgtg
ctctgcccagatttcagaagctgcaacttttcccagagcgaatatctcatctaccaggag
agccagcgctgcctgcgctacctgctagagattcacctctga

DBGET integrated database retrieval system