KEGG   Bos indicus (zebu cattle): 109564980Help
Entry
109564980         CDS       T04792                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00564  Glycerophospholipid metabolism
biu00565  Ether lipid metabolism
biu00590  Arachidonic acid metabolism
biu00591  Linoleic acid metabolism
biu00592  alpha-Linolenic acid metabolism
biu01100  Metabolic pathways
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04072  Phospholipase D signaling pathway
biu04217  Necroptosis
biu04270  Vascular smooth muscle contraction
biu04370  VEGF signaling pathway
biu04611  Platelet activation
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04724  Glutamatergic synapse
biu04726  Serotonergic synapse
biu04730  Long-term depression
biu04750  Inflammatory mediator regulation of TRP channels
biu04912  GnRH signaling pathway
biu04913  Ovarian steroidogenesis
biu04921  Oxytocin signaling pathway
biu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109564980 (PLA2G4E)
   00565 Ether lipid metabolism
    109564980 (PLA2G4E)
   00590 Arachidonic acid metabolism
    109564980 (PLA2G4E)
   00591 Linoleic acid metabolism
    109564980 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    109564980 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109564980 (PLA2G4E)
   04010 MAPK signaling pathway
    109564980 (PLA2G4E)
   04370 VEGF signaling pathway
    109564980 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    109564980 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109564980 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109564980 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    109564980 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    109564980 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    109564980 (PLA2G4E)
   04913 Ovarian steroidogenesis
    109564980 (PLA2G4E)
   04921 Oxytocin signaling pathway
    109564980 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109564980 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    109564980 (PLA2G4E)
   04726 Serotonergic synapse
    109564980 (PLA2G4E)
   04730 Long-term depression
    109564980 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109564980 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    109564980 (PLA2G4E)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     109564980 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2 CEP76-C2
Motif
Other DBs
NCBI-GeneID: 109564980
NCBI-ProteinID: XP_019824148
Position
10
AA seq 860 aa AA seqDB search
MTLQTSEGHPGLGTDVFVPQSLQWDEEGSMAGRSVCESEQIQVLETPHLTSLLPXAPDGS
QEGLSPCHLLTVRVIRMKNVRQADVVSLTDCFVSLWLPTASEKRLRTRTXSNCQNPEWNE
TFSFQIQSQVKNVLELSVCDEDTVTPDDHLLTVLYDLTKLCFRKKTHVKFPLNTEGMEEL
EVEFLLEESPSPPESLITNGVLVSRQMSCLEVCAESRRPKKRKKKDLLVTVTESFEHTQH
ISPCLESCCSNLACFQYPKYFQPEVHVELPKSPWICELCCCARQKGPVCQSLHCLPDGQA
VTLPLNENCELHMKSTPCSQALDVRLGFSLCQAELEFLQKRRVVAAQALKEVLQLEEDLR
ADEVPLIAIMATGGGTRSMTAMYGHLLALQKLNILNCASYITGLSGATWTMATLYRDPDW
SSKNLERAILEARRHVVKDKMPALFPDQLLKFEEELQQRRQEGYKVTFTDFWGLLIEACL
GDERNECKLSDQRAALCHGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGMQKYGAFI
PTELFGSEFFMGRLMKRIPESRMCYMLGLWSSIFSLNLLDAWNLSHTSEEFFHKWTRDRV
HDIEDEPLLPEIPKCDANVLDTTVVTPASWLSNTFRDILTHRAFVSKFHNFLLGLQLHTD
YLQNSQFSMWKDTVLDGFPNQLTGSVKHLCLLDTAFFVNSSYAPLLRPERKVDLIIHLNY
CAGSQTKPMKQTCEYCAVQNIPFLKYELQKEEDSLKECYLLENSQEPDTPIVTFFPLICD
TFQNYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAAFDKLVKLSEYNILNNKDK
LLQALRLAVERKRQKSQCPP
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgactctccagacgtcggaaggccatcctggcttgggaacggatgtgtttgtccctcag
agccttcagtgggatgaagaaggcagcatggcaggaaggagtgtctgtgagtcagagcag
atacaggtcctggaaactccccatctcacatctctacttcccrtggcccctgatggctct
caggaggggctgtctccatgccacctgctgacagtgagggtcatccgcatgaagaacgtc
cgacaggccgacgtggtgagcctgacagactgcttcgtgagcctstggctgcccactgcc
agtgaaaagaggctgaggactaggaccrtctccaactgccaaaacccagaatggaatgag
accttcagcttccagatccagagccaagtgaagaatgttctagagctgagcgtctgtgat
gaagacacggtgacacctgatgaccatctcttgacagttctctatgacctcaccaagctc
tgcttccgaaagaaaacccacgtgaagttcccgctcaacacagagggcatggaggagctg
gaagtggagttcctgctggaggagagcccctctccacctgagagcctcatcacgaacggc
gtgctggtgtctcgacaaatgtcctgcctggaggtttgtgcagaatccaggaggccaaag
aagaggaaaaagaaggacctcctggtgacagtgacggagtccttcgagcacacccagcac
atctcaccctgcctggagtcctgctgctcaaaccttgcctgcttccaataccccaaatac
ttccagcctgaggtgcacgtggagttgcccaaaagcccgtggatctgtgagctttgctgc
tgtgcgcgccagaagggccctgtgtgccagtccctccactgcctccccgacggccaggca
gtgaccttgcctttgaatgagaactgtgaattacacatgaagtctacaccctgttcccag
gcgctggacgtgcggctgggcttcagcctgtgycaggcagaactggagttcctgcagaaa
cggagggtggtggcagcccaggcgctgaaggaggtgctgcagctggaggaggacctgcgg
gcagatgaggtcccgctgatagccatcatggccactgggggtggaacaagatctatgacc
gccatgtayggccacttgctggcgctgcagaagctgaacatcctgaactgtgccagctat
atcaccggcctgtctggggccacctggaccatggctaccttgtaccgtgaccctgactgg
tcctccaaaaacctggagcgtgccatcctcgaggcacggaggcacgtggtcaaggataag
atgcctgccctgttcccagaccagctcctcaaattcgaggaggagctccagcagcgcagg
caggaaggctacaaggtcaccttcacagacttctggggcctgctgattgaggcctgtctg
ggggatgagagaaatgaatgcaaactgtcagatcagcgtgctgctttgtgccatggccag
aaccccctgcccatctacctcaccatcaatgtcaaggatgatgtaagcaaccaggatttc
agagagtggttcgagttctccccctacgaggtrggcatgcagaagtatggagccttcatc
cccacagagctcttcggctccgagttcttcatggggcggctgatgaagagaatcccagag
tcgcggatgtgctayatgctaggtttgtggagtagcatcttctccctgaacctgcttgac
gcctggaacctatcccatacctcggaggagttttttcacaagtggacaagggatagagtg
catgatattgaagacgagccactcctgcctgaaatccccaaatgtgatgccaatgtcctg
gacaccacggtggtgacgccagcatcctggctgtccaacactttccgcgacatcctcacc
cacagggcctttgtctccaagttccacaatttcctgctggggctgcagctgcacaccgac
tacctccagaacagccagttctccatgtggaaagacacggtgctggacggcttcccaaac
cagctgacaggatctgtgaaacacctgtgcctgctggacaccgcattctttgtcaactcc
agctacgcgcccctcctcaggccygagagaaaagttgacctcattatccaccttaattac
tgtgctgggtcccagacaaagcccatgaagcaaacctgtgagtactgtgccgtgcagaac
atccccttcctcaaatacgagctgcagaaggaggaggatagcctcaaggagtgctacctg
ctggagaactcccaggagcccgacacccccatcgtgacctttttcccactcatctgcgac
accttccaaaattacaaggccccaggtgtggaacgaagccccgaggagttggagcagggc
caggttgacatctacggtcccaaaactccctacgccaccaaggagctgacatacactgag
gctgccttcgacaagctggtgaagctttctgagtataacatcctgaataacaaggacaag
ctccttcaggccttgcgactggcagtagagaggaaacgccagaagagccagtgtcctccc
taa

DBGET integrated database retrieval system