KEGG   Bos indicus (zebu cattle): 109565246
Entry
109565246         CDS       T04792                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
biu  Bos indicus (zebu cattle)
Brite
KEGG Orthology (KO) [BR:biu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109565246 (AKAP5)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     109565246 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 109565246
NCBI-ProteinID: XP_019824617
Position
10
AA seq 428 aa
MEITVSEIQVESKDETRSAEVRPQDERQEEKASMLCFKRRKKAAKAKKPKASSKAADAAK
KCPPEARASDQPQRPGGAWDSIKRLVTRRKRSESSKQQKPFKAKLQSEINAEDANPSKKK
AKSRLKIPCIKFSKGEKRSNHSKIIEDSDRSVKVQEAENLVTKTQTQSDDQATKSKSPQG
VREDVSQKGDDEVCESNVNNSITSPGEKVISVELELDMGHSAIQTGTLILEKDTEMLEEK
QSIQPQHVSPLEASDTEQELPVGSEVPPSSAVPDQQILEEARNGVLESGPDWKEHESREI
VVEESKPKDTELSQELDFQENEITAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNVP
KPFLISIENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDD
NTINNRLQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggagatcacagtttctgaaatacaagtagaaagcaaggatgagacgagatcagcagaa
gttagacctcaggatgagaggcaggaggaaaaagcatcgatgctctgcttcaagagaaga
aaaaaagcagccaaagcaaagaagcccaaagccagctctaaagctgctgatgcagcaaag
aagtgtcctccagaagcacgagcttctgatcagccacaacgccctggtggggcctgggac
tcaatcaaacgccttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaagccc
tttaaggctaaactgcaatctgaaatcaatgctgaggatgctaatccttctaagaaaaag
gcaaaatccagactcaagattccctgcataaaattctcaaaaggagagaaaagaagtaat
cactccaaaatcatagaagactcagaccgcagtgtcaaagtccaagaggctgaaaatctg
gttacaaaaactcagacccaatcagatgaccaggcaacaaagagcaagtcgccccagggt
gtaagggaagatgtctcacagaaaggggacgatgaggtctgtgaatcaaatgtgaacaac
agcataacttctcctggagagaaagtgatttcagtagaacttgagttagatatgggtcat
tctgctattcaaacaggaactctaatccttgaaaaagatactgaaatgcttgaggaaaaa
caaagcattcaacctcagcacgtgagcccattggaagcttcggacacagaacaggagctc
ccagtgggttctgaagttcctccctcatctgcagtcccagatcaacaaattctggaagaa
gccagaaatggtgtcctagaaagtggaccagattggaaggagcatgaaagtagagagatt
gttgttgaggagagtaagccaaaagatactgaattgagccaggaattggattttcaagaa
aatgagatcactgcagaaaaacccaaaccagaagaaagcaaaagaatggagccaattgct
attattatcacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccct
aagccattcttaatttcaattgaaaatgagcaagtaggggtttttgctaatgacagtggt
tttgagggtagaacttcggaacaatatgaaacactcttaatagaaacagcttcttctctt
gtcaagaatgctatccagttgtctatagaacagcttgttaatgaaatggcctctgatgat
aatacaataaacaatcgtctacagtga

DBGET integrated database retrieval system