KEGG   Bos indicus (zebu cattle): 109565265
Entry
109565265         CDS       T04792                                 

Gene name
EIF2S1
Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit 1 isoform X1
  KO
K03237  translation initiation factor 2 subunit 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03013  RNA transport
biu04140  Autophagy - animal
biu04141  Protein processing in endoplasmic reticulum
biu04210  Apoptosis
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05160  Hepatitis C
biu05162  Measles
biu05164  Influenza A
biu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109565265 (EIF2S1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109565265 (EIF2S1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109565265 (EIF2S1)
  09143 Cell growth and death
   04210 Apoptosis
    109565265 (EIF2S1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109565265 (EIF2S1)
   05012 Parkinson disease
    109565265 (EIF2S1)
   05014 Amyotrophic lateral sclerosis
    109565265 (EIF2S1)
   05020 Prion disease
    109565265 (EIF2S1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109565265 (EIF2S1)
  09172 Infectious disease: viral
   05162 Measles
    109565265 (EIF2S1)
   05164 Influenza A
    109565265 (EIF2S1)
   05160 Hepatitis C
    109565265 (EIF2S1)
   05168 Herpes simplex virus 1 infection
    109565265 (EIF2S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:biu03012]
    109565265 (EIF2S1)
Translation factors [BR:biu03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    109565265 (EIF2S1)
SSDB
Motif
Pfam: EIF_2_alpha S1 SoDot-IcmSS DUF4453
Other DBs
NCBI-GeneID: 109565265
NCBI-ProteinID: XP_019824645
Position
10
AA seq 315 aa
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTT
TLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEV
DGDDDAEEMEAKAED
NT seq 948 nt   +upstreamnt  +downstreamnt
atgccrggtctaagttgtagattttatcaacacaaatttcctgaggtggaagatgtagtg
atggtgaatgtaaggtccattgctgaaatgggcgcttatgtcagcttgctggaatacaac
aacatcgaaggcatgattcttctgagtgagttgtcaagaaggcgtatccgttctataaac
aaactcatccgaattggcaggaatgaatgtgtggttgttattagagtggacaaagaaaaa
ggatatattgatttgtcaaaaagaagagtttcaccagaggaagcaatcaaatgtgaagat
aaatttaccaaatccaaaactgtttacagcattcttcgtcatgttgctgaggtcttagaa
tataccaaggatgagcagctggaaagcctattccagaggactgcctgggtcttcgatgac
aagtacaagagacccggatatggtgcctatgatgcatttaagcacgcagtctcagaccca
tctattttggatagcttagatttgaatgaagatgaacgtgaagtactcattaacaatatt
aataggcgtttgaccccccaggctgtcaaaattcgagcagatattgaagtggcttgttat
ggttatgaaggcatcgatgccgtaaaagaagctctgagagcgggtttgaattgttctaca
gaaaccatgcccatcaaaattaatctaatagctcctcctcggtatgtaatgactacaacc
accctggagagaacagaaggcctctctgtcctcaatcaagctatggctgttataaaagaa
aaaatwgaggaaaagaggggtgtcttcaatgttcaaatggagcccaaagtggtcacagat
acagatgagaccgaacttgcaaggcagctggagaggcttgagagagaaaatgcagaagtg
gatggagatgatgatgcagaagaaatggaagccaaagctgaagattaa

DBGET integrated database retrieval system