KEGG   Bos indicus (zebu cattle): 109565294
Entry
109565294         CDS       T04792                                 

Gene name
PROC
Definition
(RefSeq) vitamin K-dependent protein C isoform X1
  KO
K01344  protein C (activated) [EC:3.4.21.69]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109565294 (PROC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109565294 (PROC)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.69  protein C (activated)
     109565294 (PROC)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109565294 (PROC)
SSDB
Motif
Pfam: Trypsin Gla FXa_inhibition EGF Trypsin_2 DUF1986 hEGF cEGF Mlo
Other DBs
NCBI-GeneID: 109565294
NCBI-ProteinID: XP_019824690
Position
2
AA seq 527 aa
MAAGGQPCSFSAAHPKPDKAEIQFSHPFYKRGDGGAVRGLAQQPCPGAGIRSDLVTRPLN
QTGGCSFRMWQLTSLLLFVTIWGISSTPAPPDSVFSSSQRAHQVLRIRKRANSFLEELRP
GNVERECSEEVCEFEEAREIFQNTEDTMAFWSKYSDGDQCEDRPSGSPCDLPCCGRGKCI
DGLGGFRCDCAEGWEGRFCLHEVRFSNCSTENGGCAHYCMEEEGRRHCSCAPGYRLEDDH
QLCVSKVTFPCGRLGKRMEKKRKTLKRDTNQVDQKDQLDPRIVDGQEAGWGESPWQAVLL
DSKKKLVCGAVLIHVSWVLTVAHCLDSRKKLIVRLGEYDMRRWESWEVDLDIKEVIIHPN
YTKSTSDNDIALLRLAKPATLSQTIVPICLPDSGLSERKLTQVGQETVVTGWGYRDETKR
NRTFVLSFIKVPVVPYNACVHAMENKISENMLCAGILGDPRDACEGDSGGPMVTFFRGTW
FLVGLVSWGEGCGRLYNYGVYTKVSRYLDWIYGHIKAQEAPLESQVP
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggcggcaggagggcaaccttgcagtttctccgcggcccaccccaaaccagataaggca
gaaatacagttttcccatccattttacaaacgaggagacggaggagcagtaaggggtctt
gcccagcaaccctgtcctggagctgggattcgctctgacttggtgacccgccctctgaac
cagacaggtggctgcagcttcagaatgtggcagcttacaagcctcttactgttcgtgacc
atctggggaatttccagcacaccagctcctcctgactcagtgttctccagcagccagcgt
gcccaccaagtgctgcggatccgcaaacgtgccaactccttcctggaggagctgcggccc
ggcaacgtggagcgtgagtgctcagaggaggtctgtgagttcgargaagctcgggagatt
ttccaaaacacggaagacacaatggccttctggtccaagtatagcgacggggaccagtgc
gaggaccggccctcagggagcccgtgcgacctcccatgctgcggacgcggcaagtgcatc
gatggcctgggcggcttccgctgcgactgcgcggagggctgggagggccgcttctgcttg
cacgaggtgcgcttctccaactgctcgacggaaaacggcggctgcgcccactactgcatg
gaggaggagggccggcgccactgcagctgcgcgcccggctaccggctggaggacgaccac
cagctctgcgtgtccaaggtgacgttcccttgtgggaggctagggaagcgaatggagaag
aaacgcaagaccttgaaacgtgacacaaaccaagtcgaccaaaaagaccagttggatcca
cggattgtcgatgggcaggaggctggatggggagagagcccctggcaggcagtgctgctg
gactccaagaagaagctggtctgtggggcagtgctaatccacgtctcctgggtgctgacg
gtggcccactgcttggacagccgcaagaagctcatcgtcaggctcggggagtatgacatg
cggcgctgggagagctgggaggtggacctggacatcaaggaggtcatcatccaccctaac
tataccaagagcaccagtgacaacgacatcgccctgctccgcctggccaagcctgccact
ctttcgcagaccattgtgcccatctgtctcccggatagtggcctctctgagcgcaagctc
acccaggtcggccaggagactgtggtgacaggctggggctaccgtgacgagaccaagaga
aaccgcaccttcgtcctcagcttcatcaaggtccctgtggtcccgtacaatgcatgtgtc
catgccatggaaaacaagatctctgagaacatgctgtgcgctggtatcctcggggacccg
agggatgcctgtgagggcgacagtggggggcctatggtcaccttcttccgtggcacctgg
ttcctggtgggcctggtgagctggggcgagggctgtgggcgcctctacaactacggcgtt
tacaccaaagtcagccgttaccttgactggatctayggccacatcaaagctcaggaggcc
cctcttgagagccaggtgccttag

DBGET integrated database retrieval system