KEGG   Bos indicus (zebu cattle): 109565363
Entry
109565363         CDS       T04792                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04024  cAMP signaling pathway
biu04210  Apoptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04668  TNF signaling pathway
biu04713  Circadian entrainment
biu04725  Cholinergic synapse
biu04728  Dopaminergic synapse
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04921  Oxytocin signaling pathway
biu04926  Relaxin signaling pathway
biu04928  Parathyroid hormone synthesis, secretion and action
biu04932  Non-alcoholic fatty liver disease
biu04935  Growth hormone synthesis, secretion and action
biu05031  Amphetamine addiction
biu05132  Salmonella infection
biu05133  Pertussis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05161  Hepatitis B
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05224  Breast cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05323  Rheumatoid arthritis
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109565363 (FOS)
   04668 TNF signaling pathway
    109565363 (FOS)
   04024 cAMP signaling pathway
    109565363 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109565363 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109565363 (FOS)
   04660 T cell receptor signaling pathway
    109565363 (FOS)
   04658 Th1 and Th2 cell differentiation
    109565363 (FOS)
   04659 Th17 cell differentiation
    109565363 (FOS)
   04657 IL-17 signaling pathway
    109565363 (FOS)
   04662 B cell receptor signaling pathway
    109565363 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    109565363 (FOS)
   04917 Prolactin signaling pathway
    109565363 (FOS)
   04921 Oxytocin signaling pathway
    109565363 (FOS)
   04926 Relaxin signaling pathway
    109565363 (FOS)
   04935 Growth hormone synthesis, secretion and action
    109565363 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    109565363 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    109565363 (FOS)
   04728 Dopaminergic synapse
    109565363 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109565363 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109565363 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109565363 (FOS)
   05231 Choline metabolism in cancer
    109565363 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109565363 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109565363 (FOS)
   05224 Breast cancer
    109565363 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109565363 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    109565363 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109565363 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109565363 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109565363 (FOS)
   05135 Yersinia infection
    109565363 (FOS)
   05133 Pertussis
    109565363 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109565363 (FOS)
   05170 Human immunodeficiency virus 1 infection
    109565363 (FOS)
   05162 Measles
    109565363 (FOS)
   05161 Hepatitis B
    109565363 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109565363 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109565363 (FOS)
   05142 Chagas disease
    109565363 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109565363 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109565363 (FOS)
   04131 Membrane trafficking [BR:biu04131]
    109565363 (FOS)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    109565363 (FOS)
Membrane trafficking [BR:biu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109565363 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 109565363
NCBI-ProteinID: XP_019824822
Position
10
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDYCTDLAVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT
LPLLNDPEPKPSVEPVKSVGSMELKAEPFDDYMFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctctggcttcaacgccgactacgaggcatcctcctcccgctgcagcagcgcc
tccccggccggggacagtctctcctactaccactcaccggccgactccttctccagcatg
ggttctcccgtcaatgcgcaggactactgcaccgatctggccgtctccagtgccaacttc
atcccaacagtgactgccatctcgaccagcccggacctacaatggctagtacagcccacc
ctagtctcctccgtggccccgtcccagaccagagccccccacccctatggagtccctact
ccctcagctggggcttactccagggctggagtcatgaaaaccatgacaggaggcagagct
cagagcattggccggaggggcaaggtagaacagttgtccccagaagaagaagagaaaagg
cgaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagggag
ctgactgacaccctccaagcggagacagaccaactagaagatgagaagtcggctttgcag
acagagattgccaatctgctgaaggagaaggaaaaactcgagttcatcctagcggctcac
cgacctgcctgcaagatccccgatgacctgggcttcccagaagagatgtctgtggcttct
cttgatctgagtgggggcctgcctgaggctgccacccctgaatctgaggaggccttcacc
ctgccactcctcaatgaccctgagcccaagccctcagtggagcccgtcaagagcgtcggc
agcatggagctgaaggctgagccctttgatgactacatgttcccagcatcatccaggccc
agcggctcggagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca
gcagactgggagcccctgcatggtggctccctggggatggggcctatggccacggagctg
gagcccctgtgcaccccggtggtcacctgtactcccagctgcactacttacacgtcttcc
ttcgtcttcacctaccctgaggctgactccttccccagctgtgcggctgcccaccgcaag
ggcagcagcagcaacgagccttcctctgactcgctcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system