KEGG   Bos indicus (zebu cattle): 109565684
Entry
109565684         CDS       T04792                                 

Gene name
TFPI
Definition
(RefSeq) tissue factor pathway inhibitor isoform X1
  KO
K03909  tissue factor pathway inhibitor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109565684 (TFPI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109565684 (TFPI)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109565684 (TFPI)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   109565684 (TFPI)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   109565684 (TFPI)
SSDB
Motif
Pfam: Kunitz_BPTI zf_CCCH_5
Other DBs
NCBI-GeneID: 109565684
NCBI-ProteinID: XP_019825150
Position
2
AA seq 304 aa
MKKEQILGVSVCLLLSCASAPLNAVPEEGEEYTNITDAELPPLKPVHSFCAMRVDDGPCK
AMIKRFFFNIHTQQCEEFIYGGCKGNQNRFETLEECKQKCTRDYPKNTRKMKTTLQKEKP
DYCFLEEDTGICRGYIIRYFYNNQSKQCERFTYGGCLGNLNNFESLEECKNTCEDTLNDF
QVDDHKIQDNAMNNASLTPQPSKEPSSFEFNGPSWCLTPADRGLCQANVTRFYYNSVIGN
CLPFKYSGCGGNENNFTSRKACVRACKKGFIQRISKEGLIKTKRKRKMQRVKLEYKFVTL
QHYF
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaagaaagaacagattttgggggtttctgtatgtctgctgcttagctgtgcttctgcc
cctctcaatgctgttcctgaggaaggtgaagaatatacaaacattacagatgctgagttg
cctccactgaaacctgtgcattcattttgtgccatgagagtagatgatggcccatgcaaa
gcaatgataaagagattttttttcaatattcatactcaacaatgtgaagaatttatatat
ggaggatgtaaaggaaatcagaatcgatttgaaactctggaagagtgcaaacaaaaatgt
acaagagattatccaaagaacacgcgaaagatgaaaacaacactgcaaaaagaaaagcca
gattactgctttttggaagaagatactggaatctgtcgtggttatatcattaggtatttt
tataacaatcaatcaaagcagtgtgaacgtttcacatatggtgggtgtctcgggaatctc
aacaactttgaatcactagaagaatgcaagaayacctgtgaagacacattgaatgatttc
caggtagatgatcataaaatccaggataatgctatgaataatgcctccttgactccccag
cctagcaaggaacccagctcctttgaatttaatggcccctcctggtgtctgaccccagca
gataggggattgtgtcaagccaatgtgaccagattctactacaattcagtcattgggaat
tgcctcccatttaaatacagtggatgtggagggaatgagaacaattttacctctagaaaa
gcatgcgttagggcttgtaaaaaaggtttcatccaaagaatatcaaaagaaggattaatt
aaaaccaaaagaaaaagaaagatgcagcgagtgaaattagaatataaatttgttacatta
caacattatttctaa

DBGET integrated database retrieval system