KEGG   Bos indicus (zebu cattle): 109565686
Entry
109565686         CDS       T04792                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
biu  Bos indicus (zebu cattle)
Brite
KEGG Orthology (KO) [BR:biu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109565686 (ADAMTS13)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     109565686 (ADAMTS13)
Peptidases and inhibitors [BR:biu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   109565686 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin_3 Reprolysin_4 TSP1_spondin Reprolysin Reprolysin_5 Peptidase_M10 TSP1_CCN Reprolysin_2
Other DBs
NCBI-GeneID: 109565686
NCBI-ProteinID: XP_019825148
UniProt: A0A6P5CI71
Position
11
AA seq 1429 aa
MAPSAQGRGVRGTLTSALFFLSCWALPDPRQQFLQALEPADVTSYFGPDAAFEGPRLSAL
PAPSPGRPPAPRLRRRAAGHVLHLELLVAVGPDVHRTHGEETERYVLTNLNMGSELLRDP
SLGAQFRVHLVKMVILTQPEDAPEITANITASLLSVCEWSRTVNPEDDTDPGHADLVLYI
TRFDLELPDGNRQVRGVTQLGGACSSSWSCLITEDTGFDLGLTIAHEIGHSFGLEHDGVP
GSGCGPSGHVMASDGAAPALALGGPAWSPCRSAGRARCLWDPPGPXSGPEGQPPEVQPGL
YYGADEQCRVAFGPAAVACTFRGEHLDMCQALSCHTDPLDPSSCSRLLIPLLDGTECGVG
KWCSKGHCRSLAELAPVGVVHGHWSGWGPASPCSRSCGGGVITRRRRCNNPRPAFGGRTC
VGSDLQAEMCNTQACEKTQLEFMSEQCAQTDSEPLRLSPGGSTAFYRWGTAEQYSEGNAL
CRHVCRAVGESFMVRRGDRFLDGTRCVPGDPQEDGALRLCVSGSCRTFGCDGRMDSGQVR
DVCQVCGGDNSTCQPQSGSFTAGRAREYVTFLTVTPNLTSIYIINRRPLFTHLAVRVRGR
YVVAGNGSASASTSYPSLLEDNRVEYRVTLSEDRLPRREEIRIRGPTRDDMEIQVYRRYG
EEYGSPARPDITFTYFQPEQRRAWAWVPVQGPCSVSCGAETCTPGPCPPHWEAGDFGPCS
ASCGGGLREREVRCVEARGGLLRTVPRSRCRALAPQPAAMDTCNSQPCPQRETDACSSAC
GTDPAVQNTTCVLGSDGTGLLVTAGPCSADEKPPAPEPCVEATCPPGWDQLDVRPPGREA
ASPAGGPGLEALAAHVWTPLAGPCSVSCGQGLVELRFVCMDTALRTPVREELCDLASKPG
SRREACQAAPCPARWETRALAPCPVTCGGGQVPLAVRCVRMDQGRLVSLPHSKCWPMPRP
RTLEDCSLEPCPARWRYKLAACSLSCGGGVAQRILYCARAHGEDTDEEILPDTQCQGLPR
PEQQEACSPEPCPPRWKVTSLGPCSASCGLGTATRSLACVRLDHGQDTEVDGAACAGLVQ
PQASIPCIVADCAYRWHVSAWTQCSVSCGEGIQHRHDACLGPGAQVPVPADFCQHLPKPV
TVRGCQAGPCVGQGMASPAPREEATAPGQTTAATAASLEWPQPHTRLLSPAQGRLPGPQE
SPVETSVCGRQHLGPTGIIDMRGTARPDCAVAIGRPLGEVVTLRFLEGSLNCSAGEMLLL
WGRLVWRKMCGKPAGMVFSSQANTLLVRQRLVRPGGGVLLRYSSQPALGAFHRGCDMQLF
GPRGEISSPSMSPDGRNVGGCRIFIDVAPWARIAIHALTVDSGTRAEGTDASYILIRDIH
SLRTTAFRGQKTLYWESEGSQAEMEFSQGFLEAHASLRGQYWTLHTRAG
NT seq 4290 nt   +upstreamnt  +downstreamnt
atggctccctctgcacaggggagaggcgtgcgggggaccctcacttctgcgctcttcttc
ctgagctgctgggcactccctgatccccggcagcagtttctgcaggccctggagccagcg
gacgtgacctcttactttggccctgatgctgcctttgaaggaccccggctctcagccctg
cccgctccctcaccaggccgcccccctgcccctcgcctccggagacgggccgccgggcac
gtcctgcacctggagctgctggtggccgtgggtcctgacgtccaccggacccacggkgag
gagacagagcgctacgtgctcaccaacctcaacatggggtcagagctgctgagggaccca
tccctgggggctcagttccgagttcacctggtgaagatggtcatcctgacccagcctgag
gatgctccagagatcacagctaacatcaccgcgtcgctgctgagcgtctgtgaatggagc
aggacagtgaaccccgaggacgacacggaccccgggcatgctgacctggtcctgtacatc
accaggtttgacctggaattgcccgatggtaaccggcaggttcggggggtcacccagctg
gggggcgcctgctcctcctcctggagctgccttatcactgaggatactggctttgacctg
gggctcaccatcgcccatgagattgggcacagcttcggcctggagcacgatggcgtgccg
ggcagcggctgcgggcccagcggccacgtgatggcctcggacggcgcggcgcccgccctc
gccctcgggggcccggcgtggtcgccttgtcgcagcgcaggacgggcgcgctgcttgtgg
gaccctccggggccgcngtccgggcccgaagggcagcctcccgaggtgcagcccggcctc
tactacggcgcagacgagcagtgccgcgtcgccttcggccccgcggcggtcgcctgcacc
ttccgcggggagcacctggacatgtgccaggctctctcctgccacacagaccccctggac
ccaagcagctgtagccgcctgcttattcctctcctggatgggacagagtgtggcgtgggg
aagtggtgctccaagggtcactgccgctcgctggcggagctggcccccgtgggggtggtg
cacgggcactggtctggctgggggcccgccagtccttgctcccgctcctgcggaggcggc
gtgattaccaggagacggcggtgcaacaaccccagacctgcctttggggggcgcacgtgc
gtaggttcggacctgcaggccgagatgtgcaacacccaggcctgcgagaagacccagctg
gagttcatgtctgagcagtgtgcgcagacggacagcgagcccctgcgcctctccccaggg
ggcagcaccgccttctaccgctgggggaccgcagagcagtacagcgaagggaacgccctg
tgcagacacgtgtgccgggccgtcggcgagagtttcatggtgcggcgtggggaccgtttc
ctggacggcacgcgctgtgtgccgggcgaccctcaggaggacggggccctgaggctgtgc
gtgtcaggcagctgcaggacgtttggctgtgatggcaggatggactccgggcaggtgcgg
gacgtgtgccaggtgtgcggcggggacaacagcacgtgccagccacagagcggctccttc
acggccggaagggccagagagtacgtcacgttcctgaccgtcacccccaacctcaccagc
atctacatcatcaaccgcaggcctctcttcacacacctggcggtgagggtgcgtggccgc
tacgtcgtggccggaaacgggagcgcgtctgccagcaccagctacccctccctcctggag
gacaaccgcgtggagtacagggtcaccctgagcgaggaccggctgccccgccgggaggag
atccgcatccggggccccacccgggacgacatggagatccaggtttacaggcgctacggt
gaggagtacggcagccccgcccgccccgacatcaccttcacctacttccagccggagcag
cggcgggcctgggcgtgggtcccggtgcaagggccctgctccgtgagctgcggggcagag
acctgcacccctgggccctgccccccgcactgggaggctggagacttcggcccctgcagc
gcctcgtgtgggggtggcctgcgggagcgagaggtgcgctgcgtggaggcccggggcggc
ctgctgaggaccgttccccgctcccggtgcagagcgctggccccgcagccggcggccatg
gacacctgcaattcccagccctgcccccagagggaaacagacgcgtgctcgtcggcctgt
ggcacagacccggccgtgcagaacacgacgtgtgtgctggggtcagatggcacggggctg
ttggtgactgctgggccctgctctgcagacgagaagccgcctgccccggagccctgtgtc
gaggcgacatgtcctcccggctgggaccagctggacgtccggcccccggggcgggaggct
gcgtccccagcgggcggccccgggctggaggcacttgccgcgcacgtgtggacacccctg
gcggggccctgctctgtctcctgtggtcaaggcctggtggaactgcgttttgtgtgcatg
gacactgccctcaggacacccgtccgggaagagctgtgtgacctggcaagcaagcctggg
agccggcgggaggcctgccaggctgccccgtgcccggccaggtgggagacccgagccttg
gcaccgtgcccggtgacctgtggaggcgggcaggtgccactggctgttcgctgtgtgagg
atggaccaaggccgcctcgtctccctgcctcactccaagtgctggcccatgccccggcct
aggaccctggaggactgcagcctggagccctgccctgccaggtggcggtacaagctggcc
gcttgcagcctgagctgtgggggaggggtggcgcagaggatcctgtactgtgcccgggcc
cacggcgaggacacggacgaggagatcctgccggacacccagtgccaggggctgccccgc
ccggagcaacaggaggcctgcagcccggagccctgcccgcccaggtggaaagtcacgtcc
ctcggcccgtgctcggccagctgtgggctaggcacagccacacgctcgctggcctgtgtg
cggctggaccacggccaggacacagaggtggacggggcagcctgcgcrggtcttgtgcag
ccacaggccagcatcccttgcatcgtcgctgactgtgcctaccggtggcacgtcagcgcc
tggacacagtgctccgtctcctgtggggagggcatccagcatcggcacgacgcctgccta
ggacctggggcccaggtgcctgtgcccgccgacttctgccagcacctgcccaagccagtg
accgtgcggggctgccaggctgggccctgcgtggggcaggggatggccagcccggcgccc
cgtgaggaagccactgctccaggccagaccacagctgccacagctgcgtccctggagtgg
ccccagccccacacccgcctcctctccccagctcaaggacgcctgcccgggccccaggaa
agcccagtggagaccagtgtctgtggccggcagcaccttgggccaacgggaatcatcgac
atgcgaggcacggcgcggccagactgtgcggtggccatcgggcggcccctgggtgaagtg
gtgactctccggtttctggagggttctctcaactgcagtgctggggagatgctgctgctt
tggggcaggctcgtgtggaggaagatgtgcgggaagccggccggcatggttttcagctcc
caagccaacacgctgctggtgaggcagcgtcttgtgcggcccggaggcggagtgctgctg
cggtattcaagccagcctgccctgggagccttccaccgaggatgtgacatgcagctcttc
ggaccccggggcgaaatctcgagcccatcgatgagtccagatgggaggaacgtggggggc
tgtcgcatcttcatcgacgtggccccgtgggcccggattgccatccatgccctgaccgtg
gacagcggcaccagagccgagggaactgatgccagttacatcttgatccgggacatccac
agcctgaggacaacagcatttcgtgggcagaagacgctctactgggagtcagagggcagc
caggcagagatggagtttagccagggcttcctggaagcacacgccagccttcggggccag
tactggaccctccacacgagagctggttag

DBGET integrated database retrieval system