KEGG   Bos indicus (zebu cattle): 109565710
Entry
109565710         CDS       T04792                                 

Gene name
BCL2L11
Definition
(RefSeq) bcl-2-like protein 11 isoform X1
  KO
K16341  Bcl-2-like protein 11
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04068  FoxO signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04932  Non-alcoholic fatty liver disease
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109565710 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    109565710 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109565710 (BCL2L11)
   04215 Apoptosis - multiple species
    109565710 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109565710 (BCL2L11)
   05206 MicroRNAs in cancer
    109565710 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109565710 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109565710 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109565710 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109565710 (BCL2L11)
SSDB
Motif
Pfam: Bim_N Bclx_interact PMAIP1
Other DBs
NCBI-GeneID: 109565710
NCBI-ProteinID: XP_019825172
Position
11
AA seq 195 aa
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPL
APPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
NHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVL
LRVLRYIVRLVWRMQ
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcaaagcaaccttccgatgtaagttctgagtgtgacagagaaggtggacaattgcag
cctgccgagaggcctcctcagctcagacckggggcccccacctctttacagacagagcgg
caaggtaatcctgaaggagaaggggaccgctgcccccaaggcagcccacagggcccgctg
gccccaccggccagccctggccctttcgctaccagatccccgctcttcatcttcgtgaga
agatcctccttgctgtctcgatcctccagtgggtatttctcttttgacacagacaggagc
ccggcacccatgagttgtgacaaatccacacagaccccaagccctccttgccaggccttc
aaccattatctcagtgcaatggcttccatgaggcagtctcaggctgtacctgcagataca
cgcccagagatatggattgcccaagagctacggcgtatcggagacgagtttaatgcatat
tacccaagaagggtcttcgtgcgtcaccaggcagttgagggccacccgcaaatggtcctc
ttgcgcgtcttgcgctacatcgtgcgtctggtgtggaggatgcagtga

DBGET integrated database retrieval system