KEGG   Bos indicus (zebu cattle): 109565743
Entry
109565743         CDS       T04792                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V
  KO
K06487  integrin alpha V
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04514  Cell adhesion molecules
biu04810  Regulation of actin cytoskeleton
biu04919  Thyroid hormone signaling pathway
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05222  Small cell lung cancer
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109565743 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109565743 (ITGAV)
   04514 Cell adhesion molecules
    109565743 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109565743 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109565743 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109565743 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109565743 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109565743 (ITGAV)
   05205 Proteoglycans in cancer
    109565743 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109565743 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109565743 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    109565743 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109565743 (ITGAV)
   05414 Dilated cardiomyopathy
    109565743 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109565743 (ITGAV)
   05165 Human papillomavirus infection
    109565743 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109565743 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109565743 (ITGAV)
   04515 Cell adhesion molecules [BR:biu04515]
    109565743 (ITGAV)
   04090 CD molecules [BR:biu04090]
    109565743 (ITGAV)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    109565743 (ITGAV)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109565743 (ITGAV)
  Exosomal proteins of epithelial cells
   109565743 (ITGAV)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin alpha subunits
   109565743 (ITGAV)
CD molecules [BR:biu04090]
 Proteins
  109565743 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 109565743
NCBI-ProteinID: XP_019825221
Position
2
AA seq 777 aa
MASLPRRRLRLRPRRLLLLLPGILLPLCGAFNLDVESPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSHRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPKVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQKASGDFQTIK
LNGFEVFARFGSAIAPLGDLDQDGFNDITLPAKEMGDKKGIVYIFNGRPTGLNAVPSQIL
EGKWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAVLYRARPVITVNAGLEVYP
SILNQENKTCPLPGTDLKVSCFNVRFCLKADGKGALPTKLDFQVELLLDKLKQKGAIRRA
LFLHNRSPGHSKNMTISRGGQMQCEELIAYLRDESEFRDKLTPITIFMEYWLDYRTAADA
TGLQPILNQFTPANVSRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKA
QNQGEGAYEAELIVSIPLQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAGT
QLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSYKVDLAVLAAVEIRGSV
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggcttctctgccgcggcggcgactgcgccttcgcccccgccgcctcctgctccttctc
cccggaatcctgctgcctctttgcggcgccttcaatctagatgtggagagtcctgcggag
tactccggcccagagggaagttatttcggcttcgcggtggacttcttcgtgcccagcgcg
tcttccaggatgtttcttctggtgggagcgcccaaagcaaacactacccagcctgggatt
gtggaaggagggcaagtccttaagtgtgactggtcttctcaccgtaggtgccagccaatt
gagtttgatgccacaggcaacagagattatgccaaggatgatccattggagtttaagtct
catcagtggtttggagcatctgtgaggtcaaaacaggataaaattttggcctgtgcccca
ctgtatcactggaggactgagatgaagcaggaaagagagcctgtgggaacatgctttctt
caggacggaacaaagactgttgagtatgctccatgcagatcaaaaaatatwgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagtttttattggcaaggtcaactcatttccgatcaagtagcagaa
attgtatctaaatatgaccccaaagtttacagcatcaagtataataaccagttagcaacc
cggactgcacaagctatttttgatgacagttatttgggttactcggtggccgtcggagat
ttcaacggtgatggcatagatgacttcgtttcaggagttccaagagcagcgaggactttg
ggaatggtttatatttatgatgggaaaaacatgtcctccttacacaattttactggtgaa
cagatggctgcatattttggattttctgtcgctgccactgacattaatggggatgattac
gcagatgtgtttatcggcgcacctctcttcatggatcgcggttctgatggcaaactccag
gaggtggggcaggtctcggtgtctctgcagaaagcttcgggggacttccagaccatcaag
ctgaatggttttgaggtctttgcaaggttcggcagcgccatagcccctttgggagatcta
gaccaggatggcttcaatgacattactttgccagcaaaggagatgggagataaaaaagga
attgtttatattttcaatggaagacccacaggcttgaatgcagtaccgtctcagatcctt
gaagggaagtgggcagctcggagcatgccaccaagcttcggctattccatgaaaggagcc
acggatatagacaagaatggatatccagacttaattgtaggagcttttggtgtcgataga
gctgtattatacagggccagaccagttatcactgtaaatgctggccttgaagtgtaccct
agcattttaaatcaagaaaataaaacctgccctctgcctgggacagatctcaaagtttcc
tgttttaatgtcaggttctgcttaaaggcagatggcaaaggagcacttcctacgaagctt
gacttccaggtggagcttcttttggataaactcaagcagaaaggagcaattcgacgagca
ctctttctccataacaggtccccgggtcactccaagaacatgaccatctcaaggggggga
cagatgcagtgtgaggagctgatcgcatatctgcgggatgaatctgaatttagagacaaa
ctcactccaattactatttttatggagtattggttggattatagaacagctgctgatgca
acagggttgcaacctattcttaaccaatttactcctgccaatgttagtcgacaggctcat
attctacttgactgtggtgaagacaatgtctgtaagcccaaactggaggtttctgtagat
agtgatcaaaagaagatctatattggggacgacaaccctctgaccttgattgttaaggct
cagaatcagggggaaggtgcctatgaagccgagctcatcgtttccatcccactgcaggct
gatttcatcggggttgtccgtaacagtgaagccttagcaagactttcctgtgcgtttaag
acagaaaaccaaacccgccaggtggtttgtgaccttggaaacccaatgaaggctggaact
caactcttagctggtctccgtttcagtgtgcaccagcaatcagagatggatacgtctgtg
aaatttgatttacaaattcaaagctccaatctttttgataaagtaagcccggttgtatct
tacaaagttgaccttgctgttttagctgctgttgagataagagggtcagtatga

DBGET integrated database retrieval system