KEGG   Bos indicus (zebu cattle): 109565841
Entry
109565841         CDS       T04792                                 

Gene name
AFF3
Definition
(RefSeq) LOW QUALITY PROTEIN: AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
biu  Bos indicus (zebu cattle)
Brite
KEGG Orthology (KO) [BR:biu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:biu03021]
    109565841 (AFF3)
Transcription machinery [BR:biu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     109565841 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 109565841
NCBI-ProteinID: XP_019825352
Position
11
AA seq 1252 aa
MDSFDLALLQEWDLESLWGEDILNQRNDSLVVEFQSSASRCRSVYEPDRNVLRRKERERR
NQEAQQDDGXFNSSYSLFSEPYKTNKGDELSNRLQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGVPQAPVTKIDEHFVADSRAQTQPASVCSTTSSTPAAVPGQQSKRGAMGWQKAGHPP
SDGQQRATQQGTLRTLLGDGVGRQQPRTKQVCNVEVGLQTQDRPPAMGAKHSXNGHCVQN
FPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSAETGVHCLYRGVPATKSESAR
AKAKLSKFSIPKQGEESRSGETNSCVEEIIREMTWPPALAAIQPPGKVEPSKFPFPNKDS
QLASSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTALHALSDSA
GLQPADCRASAPSSKGSSSGSSSSGSSSSSDSESSSGSDSETESSSSESEGSKPPHYSSP
EAEPASSNKWQLDKWLNKVNHHKPPVLIQNESHHGPESSQYYTPVKEDTQDCGKLPDVCP
PGLRDKDIKGACKEEQRPRTANKAPGSKGVKQKSPPAAVAVXXXXXXXXXXXXXXXXXXS
APAPARRSAGKKPTRRTERTXAGDSGHRPEEPVAAEALGASTGVPPEPPKPRPCGNSRTN
HRKELRSAVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEDYPLSKAVAA
AAAAAAASGNDPRLKEAPTSISGGGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNEL
LSPLKDSDEVRSLWVKIDLTLLSRIPEHLPQEPGVLSAPAAKDSESAPPSHASEAPVEKT
LPKSKRKRKCDNEDDYREIKKAPGERESASRLSASANSTLSANHCSMNINSLAIPINKNE
KVLRSPISPLSDASKHKFSGEDLTSSSRSNSNGLFTSTSSSKKHKAESQLQSHAADLTKA
AHNNSENILHKSRPQTEPWSPGSNGHRDCKRQKLIFDDMPRSADYFMQEAKRMKHKADAM
VEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNAT
PEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKST
GTPSPMSPNPSPTGSVGSQGSLSNSNALSPSTIVSIPQRIHQMAANHVSITNSILHSYDY
WEMADNLAKENREFFHDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSAHLA
NT seq 3759 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcgctgtggggtgaa
gacatcctaaaccagaggaatgactctctagttgtggagtttcagtcatcagccagcaga
tgcaggagtgtctacgaaccggatagaaacgtgttacggaggaaagaacgagaaagaaga
aaccaggaagctcagcaggacgatggcrcgtttaattcgagttactccctctttagtgaa
ccctacaagactaacaagggggatgagctctccaaccggctccagaacactttaggcaat
tacgatgaaatgaaagactttctcacggatcgatcaaaccagagtcatcttgtgggtgtt
cccaaacctggggttcctcaggctcccgtgaccaagattgatgaacattttgtggcagat
tcaagagcccagactcagccagcatccgtctgcagcaccacatcctccaccccagcagcc
gtccctgggcagcagagtaagcggggtgccatgggctggcagaaggctgggcacccgccg
tccgatggccaacagagagcaacacaacagggcactctcaggaccttgcttggcgatggc
gttggcagacagcagccgcggaccaaacaggtgtgcaatgtcgaggtgggtcttcagacc
caggacaggccccctgctatgggagccaagcacagyrgcaatggccactgcgtgcagaac
tttcctccctccctggcttcgaaacccagccttgtccagcagaagcctactgcctatgtg
cggcccatggatggccaagatcaggcgcccgatgagtctccgaagctaaagtcgtctgca
gagactggcgtgcactgcttgtacaggggtgtcccggccaccaagtcagagtcagccaga
gccaaggccaagctctccaagttcagcatccccaaacaaggagaggagagtcgatctgga
gaaaccaacagctgtgttgaagaaatcattcgggagatgacctggcctccagcacttgct
gctattcaaccacctggcaaagtggaaccaagcaaatttccatttccaaataaggactct
cagcttgcctcctctggacacaataatccaaagaaaggtgatgccgagccagagagtcca
gacaatggcacatcgaacacatcaatgctagaagatgaccttaagctaagcagcgatgaa
gaggagaatgaacagcaggcagcccagagaacggccctccatgctctgtctgacagtgcc
ggactccagccggccgactgcagggcctccgcaccctcgagcaagggcagcagcagcggc
agcagcagcagtgggagcagctcctccagcgactcggagagcagctcggggtccgactcg
gagacagagagcagttccagcgagagcgagggcagcaagcctccccactactccagtccc
gaggcggaaccagcgtcctctaacaagtggcagctggataaatggctaaacaaagtgaat
caccacaagccycctgtcctgatccaaaatgaaagccaccacgggccggagagcagtcag
tactacaccccagtgaaggaggacacgcaggactgcgggaagctccccgacgtctgcccg
cccggcctgagagacaaggacatcaagggcgcctgcaaggaggagcagaggcccaggacc
gcgaacaaggcccccgggagcaaaggggtgaagcagaagtccccgcccgcggccgtggcc
gtgnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnagagc
gcgcccgcgcctgcccggaggtccgcgggcaagaagcccacccggcgcaccgagaggacc
tyggccggcgacagcggccaccggcccgaggagccygtagctgccgaggcgctgggggcg
agcacgggggttcccccggagccccccaagccccggccttgcggcaacagcaggaccaac
caccgcaaggagctgcgctcggccgtgacctgcgagaagcgccgcactcgggggctgagc
cggatcgtccccaagtccaaggagttcatcgagacggagtcgtcctcttcctcctcctcc
tcggactcggacctggagtcggagcaggaggactaccctctgtccaaggccgtggccgcc
gccgccgccgctgccgctgcctccgggaacgacccaaggctgaaggaggctcccaccagc
atcagcggcggcggcccccgcgctcccgtgggctccatcaacgccaggaccaccagcgac
attgccaaggagctggaggagcagttctacacactggtccccttcggccgcaacgagctt
ctctccccgttgaaggacagtgacgaggtccggtcactctgggtcaaaattgacttgaca
cttctgtccaggatcccggaacacctgccccaggagccgggggtcttgagtgctcccgca
gccaaggactctgagagcgcgcccccgagccacgcatcggaggcgcccgtggaaaagacc
ttgccaaaatccaagaggaaacgcaagtgtgacaacgaagacgattacagggagatcaag
aaggccccgggagagagggagagcgcctcacgactgagcgcctctgccaacagtactttg
tcygcaaatcattgcagcatgaacatcaacagcttggcaataccaataaataaaaatgaa
aaagtgctccggtcgcccatctcacccctctccgacgcatctaaacacaaattctccggc
gaggacttgacttcctccagcagatccaacagcaayggtctgttcacctccacctcctcc
agcaaaaagcataaggcagagagccagctgcagagccaygccgcggacctcacgaaagcg
gctcacaacaattccgaaaacattctccacaagtcacggccgcagacagagccctggtct
ccaggctccaacggccaccgggactgcaagaggcagaaactcatcttcgacgatatgcca
cgcagtgcagattattttatgcaagaagctaagcgaatgaagcataaagcagatgcgatg
gtggaaaagtttggaaaggctctgaactatgcagaagcagccttgtcattcattgagtgt
ggaaatgccatggaacagggccccatggagtccaaatctccttacaccatgtattcagag
acagttgagctcatcaggtatgccatgagactaaaaacccactcaggtcccaatgccaca
ccagaggataaacagctggctgcattatgttaccgatgcctggctctcctgtactggagg
atgtttcgactcaaaagggatcacgctgtaaagtattcaaaagcacttatcgactatttc
aagaattcatctaaagctgcccaagccccatctccatggggggccagtggaaagagcact
gggaccccatcccccatgtctcccaatccgtcccccaccggctccgtgggctctcagggg
agcctgtccaacagcaacgccctgtccccatccaccatcgtcagcatcccgcagcgcatc
caccagatggcggccaatcacgtgagcatcaccaacagcattctccacagctaygactac
tgggagatggcagacaacctggccaaggaaaacagagaattcttccaygacctggacctg
ctcatggggccggtcaccctgcacagcagcatggagcacctggtccagtactcccagcag
ggcytgcactggctgcgaaacagcgcccacctggcctag

DBGET integrated database retrieval system