KEGG   Bos indicus (zebu cattle): 109565881
Entry
109565881         CDS       T04792                                 

Gene name
ITGA4
Definition
(RefSeq) integrin alpha-4 isoform X1
  KO
K06483  integrin alpha 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04514  Cell adhesion molecules
biu04640  Hematopoietic cell lineage
biu04670  Leukocyte transendothelial migration
biu04672  Intestinal immune network for IgA production
biu04810  Regulation of actin cytoskeleton
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05165  Human papillomavirus infection
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109565881 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109565881 (ITGA4)
   04514 Cell adhesion molecules
    109565881 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109565881 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109565881 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109565881 (ITGA4)
   04670 Leukocyte transendothelial migration
    109565881 (ITGA4)
   04672 Intestinal immune network for IgA production
    109565881 (ITGA4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109565881 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109565881 (ITGA4)
   05414 Dilated cardiomyopathy
    109565881 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109565881 (ITGA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109565881 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109565881 (ITGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109565881 (ITGA4)
   04515 Cell adhesion molecules [BR:biu04515]
    109565881 (ITGA4)
   04090 CD molecules [BR:biu04090]
    109565881 (ITGA4)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109565881 (ITGA4)
  Exosomal proteins of other cancer cells
   109565881 (ITGA4)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin alpha subunits
   109565881 (ITGA4)
CD molecules [BR:biu04090]
 Proteins
  109565881 (ITGA4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF11
Other DBs
NCBI-GeneID: 109565881
NCBI-ProteinID: XP_019825406
Position
2
AA seq 1033 aa
MAVEARRGPGPRGAAVWEAVMFLLCSGVPTGRPYNVDTESALLYKGPPNTLFGYSVVLHS
HGANRWLVVGAPTANWLSNTSVVKPGAIYRCKVGKNPARTCEQLQLGSPFGDPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIRTESKLPTGVCYGMPSDLRTELSKRI
APCYQDYVKQFGENFASCQAGISSFYTEDLIVMGAPGSYYWTGSLFVYNMTTNKYKAFID
KYNQVKFGSYLGYSVGAGHFRSXRSTEVVGGAPQHEQIGKAYIFSIDAKELNILHEMKGK
KLGSYFGASICAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAAMNEMETELIG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRVDGISTTFSQRIEG
RQISNSLSMFGQSISGQIDADNNGYLDVAVGAFRSDSAVLLRTRPVVIVEASLNHPESVN
RTNFDCIENGLPSVCMDLTLCFSYKGKKVPDYMVLLYNMSLDVNRKTESPSRFYFSSNGT
YDVITRSIKVQSKATSCKTHQAFMRKDVRDILTPIQIEATYHLGHHVISKRSIEEFPPLQ
PILQQKKEKDIIEKTINFARFCAHENCTADLQVSAKIGFLKPHENKTYLAVGSMKTLMLN
VSLYNAGDDAYETTLHIKLPTGLYFIKILDLEEKQINCEVTDSSGIVRLDCRVGYIYVDH
LSKTDVSFLLDASSLSRADEDLNITVHAACENEGETGDVKRNKVTVTIPLKYEVMLTVHG
FVSPASFMYGPKEEDXFEMCTTEKMNFTFHVINTGQSMAPNIGVEIMIPNSFSPRTDKLF
NILDVQTTAGECHFKNYQRKCALDQKKGTMETLKDIFRFLSKTDKRLLYCMKADPYCLNI
SCHFGKMDSGKEASVHIQLEGRPSILEMDETKALKFEIRATAFPEPNPKVIELKKDENVA
HVLLEGLHHQRPRRHFTIMIISSSLLLGLILLFFISYVMWKAGFFKRQYQSILQKENRRD
SWSYINSKSDKDD
NT seq 3102 nt   +upstreamnt  +downstreamnt
atggctgtggaagcgaggcgagggccgggcccccgaggggccgccgtctgggaggcggtg
atgtttctgttgtgctcgggagtcccgaccgggcgcccctacaacgtggacacggagagc
gcgctgctctacaagggaccccccaacaccctgttcggctactcggtggtgctgcacagc
cacggggcgaaccgatggctcgtagtcggggcgcccactgccaactggctctccaacact
tcagtggtcaaacctggggctatttacagatgcaaggttgggaagaatccagccaggacc
tgcgaacagctccagctaggtagcccttttggagatccttgtggaaagacttgcttggaa
gaaagagataatcaatggctgggggtcacgctttccagacagcctggagaaaacggctcc
attgtgacttgtgggcatagatggaaaaatatattttacataaggactgagtctaagctc
cccacgggtgtctgctatggaatgccttctgatttacgaacagaactgagtaaaagaata
gctccatgctatcaagattatgtgaaacaatttggagagaattttgcatcatgtcaagct
ggaatatctagtttttacacagaggatttaattgtgatgggagctccaggatcatactat
tggactggctctctttttgtgtacaatatgactacaaataaatacaaggctttcatagac
aaatacaaccaagtaaaatttggaagttatttaggatactcagttggagcyggtcatttt
cggagtcygcgcagtactgaggtagttggaggagcccctcaacatgaacagattggtaaa
gcatacatattcagcattgatgcaaaagaactaaatatcttacatgaaatgaaaggtaaa
aagcttgggtcttattttggagcatctatctgtgccgtggacctcaaygcagatggcttc
tcagacctactcgtgggagctcccatgcagagcaccatcagggaagaaggaagagtgttt
gtgtacatcaactctggttccggagcagcaatgaacgaaatggaaacagagctcattgga
agtgacaaatacgctgcaagattcggggaatctatagtcaatcttggcgacattgataat
gatggctttgaagatgttgctattggagccccacaggaagatgacttgcaaggtgctatt
tatatttacaatggccgagtagatgggatctcaacaaccttctcacagagaattgaagga
cgtcaaatcagtaactcattaagtatgtttggacagtctatatctggacaaattgatgca
gataacaatggatatctagatgtagcagttggtgcttttcggtctgattctgctgtgttg
ctaaggacaagacctgtagtgattgtcgaagcttctttaaaccatcccgagtcagtaaat
aggacaaattttgactgtattgaaaatggattgccctctgtgtgcatggatctgacactc
tgtttctcatataagggcaaaaaggttccagattatatggttttgctttataacatgagc
ctggatgtgaaccgaaagacagagtctccatcgagattttacttttcttccaatggaact
tatgatgtgattacaagaagcattaaagtacagagcaaagcaactagctgcaaaacacat
caagcatttatgcggaaagatgtacgggacatcctcaccccaatccagattgaagccact
taccacctggggcatcatgtcatcagtaaacgaagtatagaggaattccctccacttcag
ccaattcttcagcagaagaaagaaaaagacatcattgagaaaacaataaactttgccaga
ttttgtgcccatgaaaactgtactgctgatctacaggtttctgcaaaaattggatttttg
aaaccacatgaaaataagacctatcttgctgttggaagtatgaagacattgatgttgaac
gtgtctttatataatgctggagatgacgcatatgagacaactctgcatatcaaactcccc
accggtctttacttcattaagattttagatctggaagagaaacaaataaactgtgaagta
acagacagctccggcatagtgagacttgactgcagggttggttatatatatgtagatcat
ctatcaaagacagatgttagctttcttctggatgccagctcactcagcagagcagacgag
gatctcaacatcacagtacatgccgcctgtgaaaatgaaggggaaacaggcgatgtgaag
cgtaataaggtgactgtgacaatacctcttaagtatgaagtcatgctaacagttcatggg
tttgtaagtccagcctcatttatgtatggaccaaaggaggaagatgrgtttgaaatgtgc
acgacagagaaaatgaacttcactttccacgtcatcaacaccggccaaagcatggctcca
aatattggtgtggaaataatgataccaaattcttttagtccccgaaccgataagctgttc
aacattttggatgtccagactactgctggagaatgccattttaagaattatcaaagaaag
tgtgcattggaccagaaaaaaggcacaatggagaccctcaaagatatattcagatttctg
tcaaagactgataagaggctcctgtactgcatgaaagctgatccatattgcttaaatatc
tcatgccattttgggaaaatggacagtggaaaagaagccagtgttcacattcagttggaa
ggtcggccatccattttagaaatggatgagactaaagcattgaagtttgaaataagagca
acagcttttccggagccaaatcccaaagttattgaactaaagaaggatgagaatgttgca
catgttctcctcgaaggactacatcatcaaagacctagacgccatttcactataatgatt
atttcaagtagcttgctacttggacttattttgcttttcttcatttcttatgttatgtgg
aaggctggcttcttcaaaagacagtaccaatctatcctacaaaaagaaaacagaagagac
agttggagttacattaacagtaaaagtgataaagatgattga

DBGET integrated database retrieval system