KEGG   Bos indicus (zebu cattle): 109565903
Entry
109565903         CDS       T04792                                 

Gene name
HTRA2
Definition
(RefSeq) serine protease HTRA2, mitochondrial
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109565903 (HTRA2)
   04215 Apoptosis - multiple species
    109565903 (HTRA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109565903 (HTRA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109565903 (HTRA2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:biu03110]
    109565903 (HTRA2)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     109565903 (HTRA2)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109565903 (HTRA2)
Chaperones and folding catalysts [BR:biu03110]
 Other chaperones and cochaperones
  DegP / HtrA
   109565903 (HTRA2)
SSDB
Motif
Pfam: Trypsin_2 Trypsin PDZ_6 PDZ_2 PDZ Peptidase_S46 GRASP55_65 Tricorn_PDZ Peptidase_S32
Other DBs
NCBI-GeneID: 109565903
NCBI-ProteinID: XP_019825429
Position
11
AA seq 458 aa
MAALRAGRGAGWSLRGWRALWGGRWGKGPLLTPDLRALLTSGTPDPRTRVTYGTPSFRAR
LSVGVPEPRTCLRSRTSDLRARLIAGTPDPRTPEDSGTPGTRLRVWLAVALGAGGAVLLL
FWGGGRGPPAVLASVLGSPPTSPRSQYNFIADVVEKTAPAVVYIEILGRHPFSGREVPIS
NGSGFVVAADGLIVTNAHVVADRRRVRVRLPSGDTYEAVVTAVDPVADIATLRIQTKEPL
PTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPAKDLGLPQTNVEYIQTDAA
IDFGNSGGPLVNLDGEVIGVNTMKVTSGISFAIPSDRLREFLHRGEKKNSWFGISGSQRR
YIGVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVILDSPAHRAGLRPGDVILAIGEQL
VQNAEDIYEAVRTQSQLAVRIRRGQETLTLYVTPEVTE
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggctgcactgagggcggggcggggtgctggctggagcctccggggatggcgggctttg
tgggggggtcgctggggaaagggacccctgttgacccctgacctccgggccctgctgacg
tcaggaactcctgaccctcggacccgagtgacttatgggacccccagtttcagggcccgg
ttgtctgtgggggtccctgaaccacggacatgcctgaggtcccggacttcggatctccga
gcacggctgatcgctgggaccccagatccccggaccccggaagactcagggactcctgga
acccgtctgcgcgtgtggctagcggtggcgctgggcgctggaggggcagtactgttgttg
ttttggggcggggggcggggtcccccggctgtgctcgcctcggtccttggctcgccgccc
acctctccccggagccagtacaacttcatcgcggacgtggtggagaagacggcccctgcs
gtggtttatatcgagatcttgggcaggcaccctttttcgggccgtgaagtccctatctcg
aatggctcaggattcgtggtggctgccgatggactcatcgttaccaatgcccatgtggtg
gctgatcggcgccgagtccgtgtaaggctgcctagcggcgacacgtatgaggccgtggtc
acagctgtggatcctgtggcagacatcgccacgctgaggattcagaccaaggagcctctc
cctacgctgcccctgggacgctcagctgatgttcggcaaggggagtttgttgttgctatg
ggaagtccctttgcactgcagaacacaatcacctccggcattgtcagctctgctcagcgt
ccagccaaagatctgggccttccccaaaccaatgtggagtatatccagactgatgcagct
attgattttggaaactctggaggtcccctggtcaacctggatggggaggtgattggggtg
aataccatgaaggtcacatctggaatctcctttgccatcccttctgatcgccttcgagag
tttctgcatcgtggagaaaagaagaactcctggtttggaatcagtgggtcccagcgccgc
tacattggggtgatgatgctgaccttgactcccagcatccttgctgaactacagcttcga
gaaccaagctttcctgatgttcagcatggtgtgctcatccataaagtcatcctggactcc
cctgctcaccgggctggtctacgacctggtgatgtgatcttggccattggggagcagctg
gtacaaaatgctgaagatatttatgaagctgttcgaacccaatcccaactggcagtgcgg
atccggcgaggacaggaaactctgaccttatatgtgacccctgaagtcacggaatga

DBGET integrated database retrieval system