KEGG   Bos indicus (zebu cattle): 109565952
Entry
109565952         CDS       T04792                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
biu  Bos indicus (zebu cattle)
Brite
KEGG Orthology (KO) [BR:biu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109565952 (ANKRD53)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    109565952 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_3 Ank_4
Other DBs
NCBI-GeneID: 109565952
NCBI-ProteinID: XP_019825515
Position
11
AA seq 447 aa
MSLAEEWDQRAMGGSYYQLFAASLGNLEWLRFCLNRHRGEILADDKGFTAIHFAAQSGKL
ACLQVLVEEYKFPVNLPTNNGQTPLHLVIHGDNKTVALACIHYLIKQGAALNTQTCNGST
PLHLAAREGLLSCVKVLVQKGANVHAQDATGCKPIDYCKIWNHRVCARFLKDAMWKRDKE
DFAHEMRKLKRLKDQLALMEEDYLTEYQKEHQILREADFKKWLHHKLLLQDQSLIPSVQR
EPRAPPRATALSKTCKDGVLWPPTSFHPSPEARLQQIQQPNLPLVMSVPTYKPPTIRRPK
VWNLSSNPTRSPTAQIGYPQGVRLGVHPDPRPERDFRCFVEVRSDGHGGAHLRTVAGRQV
APVPRLPFEVVIRELHPSVRPYRMKVPQDFCSVAMEDVPRKRHLGDSSFWTDTLTMNLRE
TFDEAFLAAVRAHQGLPALPSPKPPLP
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagtctagccgaggagtgggaccagagggcgatgggaggaagctactaccaactgttc
gcggcctcattgggcaacctggaatggttgcggttctgtttaaaccggcatcgtggcgaa
atcctggccgatgacaagggtttcactgccatccactttgcagcccagagtggcaagctt
gcatgcctgcaggtcttggtggaggagtacaagtttcccgtaaacctgcccaccaacaat
ggccagacacctctgcaccttgtcatccatggtgacaacaagaccgtggccctcgcctgc
attcactatctgattaagcaaggggcggccctcaacactcagacgtgcaatggctccaca
cctctgcatctggcagcccgcgaaggcctgctgagctgtgtcaaagtcctggtgcagaaa
ggtgccaacgtccacgcacaagatgccacaggctgcaagcccattgactactgcaaaata
tggaaccaccgagtctgtgcccggttcttgaaagatgccatgtggaaacgggacaaggag
gactttgcccatgagatgaggaaactgaagaggctcaaggaccagctggccctcatggag
gaggactacctgactgagtatcaaaaggagcaccaaattctgagagaagctgacttcaag
aagtggctccatcacaagttgctactccaagaccagtccctaatacccagtgttcagcga
gagccccgtgctccaccccgggccactgccctctccaagacctgcaaggacggggtactg
tggcctcccacgagcttccacccctccccggaggcacgcctgcaacagatacagcagccc
aatctgcccttggtgatgtctgtgcccacctacaagccgcccacgatcaggcggcccaag
gtgtggaatcttagcagcaatcccaccaggtcccccaccgcccagatcggctacccacag
ggcgtccgcctgggcgtgcatcccgaccccaggccagagcgtgacttccgctgcttcgtg
gaggtgaggtccgacgggcacggtggcgcgcacctgcgcacggtggccggccgccaggtg
gcgcctgtgccccggctgcctttcgaagtggtaatccgcgagctgcacccttcggtgcgg
ccctacagaatgaaggtgccccaggacttctgctctgtcgctatggaagatgtgccccgg
aagcggcacttgggtgacagcagcttctggaccgacacgctgaccatgaacctgcgagag
acattcgacgaggccttcctggcggctgtgcgagcccatcaaggactccccgctctgcct
tcccctaaaccacccctcccttaa

DBGET integrated database retrieval system