KEGG   Bos indicus (zebu cattle): 109565970
Entry
109565970         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: TNF receptor-associated factor 6-like
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04064  NF-kappa B signaling pathway
biu04120  Ubiquitin mediated proteolysis
biu04140  Autophagy - animal
biu04144  Endocytosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04722  Neurotrophin signaling pathway
biu05132  Salmonella infection
biu05133  Pertussis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05222  Small cell lung cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109565970
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109565970
   04064 NF-kappa B signaling pathway
    109565970
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109565970
   04140 Autophagy - animal
    109565970
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109565970
   04621 NOD-like receptor signaling pathway
    109565970
   04622 RIG-I-like receptor signaling pathway
    109565970
   04657 IL-17 signaling pathway
    109565970
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109565970
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109565970
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109565970
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109565970
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109565970
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109565970
   05135 Yersinia infection
    109565970
   05133 Pertussis
    109565970
   05152 Tuberculosis
    109565970
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109565970
   05162 Measles
    109565970
   05161 Hepatitis B
    109565970
   05160 Hepatitis C
    109565970
   05168 Herpes simplex virus 1 infection
    109565970
   05169 Epstein-Barr virus infection
    109565970
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109565970
   05140 Leishmaniasis
    109565970
   05142 Chagas disease
    109565970
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109565970
   04121 Ubiquitin system [BR:biu04121]
    109565970
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109565970
Membrane trafficking [BR:biu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    109565970
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    109565970
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 Tropomyosin_1 zf-RING_5 SlyX zf-RING_11 Spc29 Med21 PspA_IM30 U-box DUF4455 UPF0242 DUF16 CENP-Q RNase_Y_N Tropomyosin DUF3450 Spc7 Sina
Other DBs
NCBI-GeneID: 109565970
NCBI-ProteinID: XP_019825540
Position
11
AA seq 542 aa
MSLLHCENSCASSQSESDCCAPMAASSCGTAAKDDSVSGTASTVTLSSSFMEEIQGYDVE
FDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFP
DNFAKXEILSLMVKCPNEGCLHKMELRHLEEHQAHCEFALMSCPQCQRPFQKCHLNIHIL
KECPRRQVPCENCAVSMAFEDKEIHEQNCPLANVICEYCNTMLIREQMPNHYDLDCPTAP
VPCTFSAFGCHEKMQRNHLARHLQENTQSHMRMKAQAVQTLSLAVAPAPQCTMPLYDSVP
PTRPSSGRHSEVHNFQETIQQLEGRLVRQDHQIRELTAKMETQSMYVNELKRTIRTLEDK
VAETEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPXX
QRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEATVRQNHEEIMDAKPELLAFQ
RPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDS
GI
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgagtctgctacactgtgaaaacagctgtgcatccagccagtccgagagcgactgttgc
gcccccatggctgccagctcctgtgggactgcagcaaaagacgacagtgtgagtgggacg
gccagcacggtgactctctccagctctttcatggaggagatccaggggtacgacgtggaa
tttgacccacccctggaaagcaaatacgagtgccccatttgcttgatggctttgcgggaa
gcggtgcagacaccttgcggccacaggttctgcaaagcctgcatcatcaaatcaataagg
gatgcaggtcacaaatgtccagttgacaatgaaatactgctggaaaaccaactatttcct
gacaattttgcaaaatgagagattctttcgctgatggtgaaatgtccaaatgaaggttgt
ttgcacaagatggaactgaggcatcttgaggagcatcaagcacactgtgagtttgctctt
atgagttgtccgcaatgccagcgtcccttccagaaatgccatcttaatattcatattctc
aaggagtgtccaaggagacaggttccttgtgaaaactgtgctgtatcaatggcatttgaa
gataaagagattcatgagcagaactgtcctttggcaaatgtcatctgtgaatactgcaat
accatgctcatcagagaacagatgcccaatcactatgatctagactgccctacagcccca
gtcccatgcacgttcagtgcttttggttgccatgaaaagatgcagaggaatcacttggca
cgccacctgcaagagaatacccagtcgcatatgagaatgaaggcccaggctgttcagact
ttaagcctcgcggtagctcctgcgcctcaatgtaccatgcctctgtatgactctgtgcct
cccacccggccttcctctgggcgtcactcagaagtccacaatttccaagaaaccattcaa
cagttagagggtcgccttgtaagacaagaccatcaaatccgggaactgactgcaaaaatg
gaaacccagagcatgtatgtaaatgagctcaagcgaactattcgaacccttgaggacaaa
gttgctgaaacagaagcacagcagtgcaatgggatttacatctggaagattggcaacttt
gggatgcacttgaaatcgcaagaagaggagaagcctgttgtcattcacagccccgggttc
tacacaggcaaacccggctacaaactgtgcatgcggctgcacctgcagctgccgannnnn
cagcgctgcgccaactacatatcgctctttgtccacacgatgcaaggggagtacgacagc
cacctgccgtggcccttccaggggacaatacgccttaccatccttgaccagtctgaagca
actgtgaggcaaaaccacgaagaaataatggacgccaaaccagagctcctggcctttcag
agacccaccatcccccggaaccccaagggttttggctacgtgacttttatgcatctggaa
gccctcagacaaagaaccttcatcaaggatgacacgttattagtacgctgtgaggtctcc
acccgcttcgacatgggcagtcttcggagggagggttttcagccacggagtactgactca
gggatatag

DBGET integrated database retrieval system