KEGG   Bos indicus (zebu cattle): 109566145
Entry
109566145         CDS       T04792                                 

Gene name
EIF2AK3
Definition
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase 3 isoform X1
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04137  Mitophagy - animal
biu04140  Autophagy - animal
biu04141  Protein processing in endoplasmic reticulum
biu04210  Apoptosis
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05160  Hepatitis C
biu05162  Measles
biu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109566145 (EIF2AK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109566145 (EIF2AK3)
   04137 Mitophagy - animal
    109566145 (EIF2AK3)
  09143 Cell growth and death
   04210 Apoptosis
    109566145 (EIF2AK3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109566145 (EIF2AK3)
   05012 Parkinson disease
    109566145 (EIF2AK3)
   05014 Amyotrophic lateral sclerosis
    109566145 (EIF2AK3)
   05020 Prion disease
    109566145 (EIF2AK3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109566145 (EIF2AK3)
  09172 Infectious disease: viral
   05162 Measles
    109566145 (EIF2AK3)
   05160 Hepatitis C
    109566145 (EIF2AK3)
   05168 Herpes simplex virus 1 infection
    109566145 (EIF2AK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109566145 (EIF2AK3)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109566145 (EIF2AK3)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   109566145 (EIF2AK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PQQ_2 Kinase-like Kdo APH
Other DBs
NCBI-GeneID: 109566145
NCBI-ProteinID: XP_019825832
Position
11
AA seq 1115 aa
MERATGPGSLARTLLLPLLLGLVAGTVTARRTSDLLAPTAEAAFGLGAAAAPTSATRVPA
TGAVIAAEVTVEDSEALPAAAGEQEAREPEPEPEEEPDIRPCGRSLVIISTLDGRIAALD
PENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMETVPFTVE
SLLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDNDEMEQEEDILLLQ
RTQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTLKPSGNKEQSKIISDVE
EQEAVMMDTVIKVSVADWKVMAFNKKGGHLEWEYQFCTPIASAWLVKDGKVIPISLFDDT
SYAPNDGXLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPTSPKALESVNS
ENAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNG
YYLPYYKRERNKRSTQITVRFLDNPNYKNIRKKDPVLLLHWWKEIVGTIVFCIVATTFIV
RRLFHPHPHRQRKESETQCQTENKYDAVSGEANDSSWNDIKNSGYVSRYLTDFEPIQCMG
RGGFGVVFEARNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLE
APPEKWQEKMDEIWLKDDSTDWPLSSPSPVDAPSVKIRRMDPFSTKECIEIIAPSPHSSR
SFSVGISCSQTSSSESQFSPLEFSGMDHGNVSKSADAVCQLQDSCLTDCEGEDGTMDGND
EGHSFELCPSEASPYIRSRERTSSSIVFEDSGCDNASSKEEPRMNQPPVGNHYANKLSAL
RHSGSXSSEPTVSVSPSRPTTLSLDLTKSSVGKLQPSSPKVYLYIQMQLCRKENLKDWLN
SRYTIEARERSVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTA
MDQDEEDQMVLTPMPGYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYPF
GTQMERVRILTDVRDLKFPPLFAQKYPREYAMVQDMLSPSPTERPEAASIIENAIFEDLE
FPEKTLLRQRSRSMSSPGAKHSRHSSSPHSPLPSN
NT seq 3348 nt   +upstreamnt  +downstreamnt
atggagcgcgccaccggcccggggtcgctggcacggacgctgctactgccgctgctgctg
gggctcgtggctgggacagtgaccgcgcggcgcacytctgacctcctcgcaccgacagcg
gaggcggcgttcggccttggggccgcggcggctcccacctcggctacgcgggtgccggcg
acgggagccgtgattgcagccgaagtgacggtggaggactccgaggcgctgccggcggct
gcaggcgagcaggaggcgcgggagccggagccggagccggaagaggagcccgatattcgg
ccgtgcggcagatcattagtgatcatcagcactttagatggccgaattgctgccttggat
cctgagaatcatgggaaaaagcagtgggatttggacgtggggtctggttccttggtgtca
tccagccttagcaaaccagaggtatttgggaacaagatgatcattccttccctggatgga
gacctcttccagtgggaccgggaccgtgagagcatggaaacagttccgtttacagttgaa
tcacttctcgaatcgtcttataagtttggagatgatgttgtcttggttggaggaaagtct
ctcactacatatggactcagtgcatatagtggaaaggtgaggtacatctgttcagctctg
ggttgtcgccagtgggataatgatgaaatggaacaagaagaagacatcttgcttctgcag
cgcacycagaaaactgtgagagccgttggacctcgcagtggcaatgagaagtggaatttc
agtgttggccactttgaacttcggtatattccagacatggaaactagagccggatttatt
gaaagcaccttaaagcccagtggaaacaaagaacagtctaaaattatttcagaygtggaa
gagcaggaagctgtcatgatggatacagtgataaaggtctccgttgcagattggaaagtt
atggcgtttaataagaagggaggacacctggagtgggaataccagttttgtactcccatt
gcatctgcctggttggttaaggatggcaaagtcattcccatcagtctttttgatgataca
agttacgcgcccaatgatggarttttagaagatgaagaagatattgtagaagctgcccgg
ggagccacagaaaacagtgtttacttgggaatgtacagaggccagctgtatctgcaatca
tcagtcagaatttcagaaaagtttcctacgagtcccaaggccttggaatctgtcaatagt
gaaaatgctattattcctttgccaaccatcaaatggaaacctctaattcattctccttct
agaactcctgtcttggtgggctctgatgaatttgacaaatgtcttagtaatgataagttt
tctcacgaagagtacagtaatggtgckctttcaatcttgcagtayccttacgataatggt
tattatctgccatactataagagggaaagaaacaaacggagcacgcagatcacggtcaga
tttcttgacaacccgaattacaagaacatccgcaagaaggaccctgttcttctcttacac
tggtggaaagaaatagttggaaccatmgtgttttgtattgtagcaacaactttcattgta
cgcagactcttccatcctcatcctcacagacaaaggaaggaatctgaaactcagtgtcaa
actgaaaataaatatgatgctgtcagtggagaagctaatgacagtagctggaatgacata
aaaaattctggataygtgtcacggtatctaacagactttgaaccaattcagtgcatgggc
cgtggggggtttggagttgtctttgaagctagaaacaaggttgatgactgcaattatgct
atcaagagaatccgtctccccaacagggaactggctcgggagaaggtaatgcgagaagtg
aaagccttagccaagcttgaacacccaggaattgtgagatatttcaatgcttggttggaa
gcgccaccagaaaagtggcaagaaaaaatggatgaaatttggctgaaagatgacagcaca
gactggccgctcagctctcctagtcccgtggacgcgccttctgttaaaatacgcagaatg
gatcctttctctacaaaggaatgtattgaaatcatagctccttcgccacacagcagcagg
tctttttcagttgggatttcttgcagccagaccagttcatccgagagccagttctctccg
ctggagttttcygggatggaccacggaaatgtgagcaagtcagcagatgcagtatgccaa
ctccaggacagctgccttacagactgcgagggggaggatggtaccatggatggtaatgat
gaagggcactcctttgaactttgtccttcggaagcttctccttacataaggtccagggag
cgaacctcctcgtctatagtatttgaagattctggctgtgataacgcgtccagcaaagag
gagcccagaatgaaccaaccccctgtgggcaaccattatgcgaataaactgtctgcactc
cggcattccggtagcaratcttcggaacctactgtgtctgtttctccgtcaagaccaacc
actttaagtttagacctcactaaaagctcggtggggaaactccagcccagttcgcccaag
gtgtatctgtacatccagatgcagctgtgcagaaaggaaaacctcaaagactggctgaac
agccgctacaccattgaggcgagagagaggagcgtatgtttgcacatctttctgcagatt
gcagaggcggtggagtttctgcacagcaaagggctcatgcacagggacctcaagccttcc
aacatattctttacaatggatgatgtggtcaaggttggggattttggactggtgacagca
atggaccaagacgaggaagatcagatggttctgaccccaatgccrggctacgccaggcac
acgggacaggtggggaccaagctgtatatgagcccggaacagattcatggcaacagctac
tctcataaagtggacatcttttctttgggcctcattctgtttgaattactatacccgttc
ggcactcaratggaaagggtcaggatcctaactgatgtaagagatctcaaatttccacca
ctatttgctcaaaaatatcctcgtgagtatgccatggtgcaagacatgctgtccccatcc
cctactgaacggccagaagcggcgagcatcattgaaaacgcgatcttcgaggacttggag
tttccagaaaagacactcctcagacagaggtctcgctccatgagctcgcccggagcaaaa
cattcaagacactccagcagcccccacagccctttgcccagcaattag

DBGET integrated database retrieval system