KEGG   Bos indicus (zebu cattle): 109566150
Entry
109566150         CDS       T04792                                 

Gene name
CD8B
Definition
(RefSeq) T-cell surface glycoprotein CD8 beta chain
  KO
K06459  T-cell surface glycoprotein CD8 beta chain
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04660  T cell receptor signaling pathway
biu05135  Yersinia infection
biu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109566150 (CD8B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109566150 (CD8B)
   04612 Antigen processing and presentation
    109566150 (CD8B)
   04660 T cell receptor signaling pathway
    109566150 (CD8B)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    109566150 (CD8B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109566150 (CD8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109566150 (CD8B)
CD molecules [BR:biu04090]
 Proteins
  109566150 (CD8B)
SSDB
Motif
Pfam: V-set Ig_3 ig I-set Ig_2 UL45 Ig_6
Other DBs
NCBI-GeneID: 109566150
NCBI-ProteinID: XP_019825850
Position
11
AA seq 210 aa
MQARLWLLLAAQLAALHGSLALVQTPAFLMVQTNQMVTLSCKTQTSPSNTRIYWLRLRQA
LSANSHYEFLAYWESKKTVYGKEVDSEKLTVHGNPPQNVLTLQNVKPADSGVYFCMIIGI
PNLIFGTGTQLSVVDVLPTSPQPTKKTSPKKKVCHQVPTRVTQKRLSCAPLILGLLAAGV
LILLVSLGVAIHLRCLQRRARLRLLKQFYK
NT seq 633 nt   +upstreamnt  +downstreamnt
atgcaggcgcggctgtggctcctcctcgccgcgcagctggcagctctgcacggcagcttg
gccctcgtgcagacccctgcattcttgatggttcagaccaaccagatggtgacgctgtcc
tgtaaaacccaaacctcaccttctaacacacgcatctactggctgcggctgcgccaggcc
ctgagcgctaacagtcactatgagtttctggcctactgggagtccaaaaagactgtgtat
ggcaaggaggtggactcggagaagttgactgtgcatggaaatcccccccagaatgtgctc
acgctccaaaatgtgaagcctgccgacagtggtgtctacttctgcatgatcattgggata
cccaacctgatctttgggacgggaactcagctgagtgtggttgatgttcttcctacctct
ccccagccaaccaagaagaccagccctaaaaagaaagtgtgccatcaagtcccaacccgg
gtgactcagaaacgtctgtcctgtgccccgctcatcctcggcctcctggcggccggtgtc
ctgattcttctggtgtccttgggtgtggccatccacctgcgctgcctgcagaggagagcc
cggcttcgtctcttaaaacagttttacaagtga

KEGG   Bos indicus (zebu cattle): 109566151
Entry
109566151         CDS       T04792                                 

Gene name
CD8A
Definition
(RefSeq) T-cell surface glycoprotein CD8 alpha chain
  KO
K06458  T-cell surface glycoprotein CD8 alpha chain
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04660  T cell receptor signaling pathway
biu05135  Yersinia infection
biu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109566151 (CD8A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109566151 (CD8A)
   04612 Antigen processing and presentation
    109566151 (CD8A)
   04660 T cell receptor signaling pathway
    109566151 (CD8A)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    109566151 (CD8A)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109566151 (CD8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109566151 (CD8A)
CD molecules [BR:biu04090]
 Proteins
  109566151 (CD8A)
SSDB
Motif
Pfam: V-set Ig_3 ig Ig_4 I-set
Other DBs
NCBI-GeneID: 109566151
NCBI-ProteinID: XP_019825851
Position
11
AA seq 242 aa
MASLLTALILPLALLLLDAAKVLGSLSFRMSPTQKETRLGEKVELQCELLQSGMATGCSW
LRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGARVSGTKFQLTLSSFLQEDQGYYFC
SVVSNSILYFSNFVPVFLPAKPATTPAMRPSTRAPTSAPQTRSVSPRSEVCRTSAGSAVD
TSRLDFACNIYIWAPLVGTCGVLLLSLVITGICYRRNRRRVCKCPRPVVRQGGKPNLSEK
YV
NT seq 729 nt   +upstreamnt  +downstreamnt
atggcctcactcttgaccgccctgatcctgccgctggccctgctgctgctcgatgccgcc
aaggtcctcgggtcgctctcgttccggatgtcgccgacgcagaaggagaccagactgggc
gagaaggtggagctgcaatgcgagttgctgcagtccggcatggcgacagggtgctcctgg
ctccgccacatacccggggacgaccccagacccaccttcctaatgtacctctccgcccaa
cgggtcaagctagccgagggactggaccccagacacatttccggcgccagggtctccggc
accaaattccagctcaccctgagcagcttcctccaggaggaccaaggctactatttttgc
tcggtcgtgagcaactcgatactgtacttcagtaacttcgtgcctgtcttcttgccagcg
aagccggccaccacgccggcgatgcggccatccacgcgggcgcccaccagcgcgccgcag
actaggtcggtctctccgcgatcagaggtgtgccggacctcggcgggcagcgcagtggac
acgagccggctggacttcgcctgcaatatctacatctgggctcccttggtcgggacctgc
ggcgtccttctcctgtcattggtcatcacaggcatctgctaccgccggaaccgaagacgt
gtctgcaaatgtcccaggcctgtggtccgacaaggaggcaagcccaacctttcagagaaa
tatgtctaa

DBGET integrated database retrieval system