KEGG   Bos indicus (zebu cattle): 109566354
Entry
109566354         CDS       T04792                                 

Gene name
SDC1
Definition
(RefSeq) syndecan-1
  KO
K06257  syndecan 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04512  ECM-receptor interaction
biu04514  Cell adhesion molecules
biu05144  Malaria
biu05205  Proteoglycans in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109566354 (SDC1)
   04514 Cell adhesion molecules
    109566354 (SDC1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109566354 (SDC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109566354 (SDC1)
  09174 Infectious disease: parasitic
   05144 Malaria
    109566354 (SDC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109566354 (SDC1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109566354 (SDC1)
   00535 Proteoglycans [BR:biu00535]
    109566354 (SDC1)
Membrane trafficking [BR:biu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    109566354 (SDC1)
CD molecules [BR:biu04090]
 Proteins
  109566354 (SDC1)
Proteoglycans [BR:biu00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   109566354 (SDC1)
SSDB
Motif
Pfam: Syndecan Romo1
Other DBs
NCBI-GeneID: 109566354
NCBI-ProteinID: XP_019826218
Position
11
AA seq 311 aa
MRRAALWLWLCALALRLQPALLHSVAVNMPPEDQDGSGDDSDNFSGSGAGALPDITSSHT
PSTWKDLGPVXTTATAPEPTSPDAIAASTTILPTGEQPEGGRAVLLAEVEPGLTAQKEAT
HPPSETTLHPTTHSXSTARATMAPGPXTSHPHRDVQPDHHETSAPTGRGRMEPHRPHVEE
GGPPATEKAAEEDPSTQIPVGEGSGEQDFTFDLSGENAAGAAGEPGSRNGAPEDPEATGA
TGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAY
QKPTKQEEFYA
NT seq 936 nt   +upstreamnt  +downstreamnt
atgaggcgcgcggcgctctggctgtggctctgcgcgctggcgctgcgcctgcagccggcc
ctcctgcacagtgtggccgtaaacatgccccccgaagatcaggatggctctggggacgac
agtgacaacttctctggctcgggcgcaggtgctttgccagatatcacctcatcacacacg
ccctccacctggaaggacctggggcccgtgaygaccacagccacggctccagagcccacc
agcccagatgccatcgccgcctccaccaccatcctgccaaccggagagcagcctgaggga
ggcagggcagtgctcctggcagaggtggagcctggcctcaccgcccagaaggaggccacc
cacccacccagtgagaccacactgcacccgaccactcacagcrtgtccacagccagagcc
accatggccccaggacccrccacctcccatccgcacagggacgtgcagcccgaccaccat
gagacctcggctcccacaggccggggccgtatggagccgcacaggccccacgtggaggag
ggaggtcctcctgccactgagaaggcggctgaggaggacccctccacccagatcccagtg
ggagagggctctggggagcaggacttcaccttcgacttgtccggggagaatgcggccggg
gccgcaggggaacctggctcacggaatggagccccggaggatcctgaggccacgggggca
acgggggcctcacagggcctcctggatcggaaggaagtcctgggaggggtcattgctgga
ggcctcgtggggctcatctttgccgtgtgcttggtgggtttcatgctgtaccggatgaag
aagaaggacgagggcagctactccttggaggagccaaaacaagccaacggcggggcctac
cagaagcccactaagcaggaggagttctacgcctga

KEGG   Bos indicus (zebu cattle): 109567481
Entry
109567481         CDS       T04792                                 

Gene name
SDC4
Definition
(RefSeq) syndecan-4
  KO
K16338  syndecan 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04512  ECM-receptor interaction
biu04514  Cell adhesion molecules
biu05205  Proteoglycans in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109567481 (SDC4)
   04514 Cell adhesion molecules
    109567481 (SDC4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109567481 (SDC4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109567481 (SDC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:biu00535]
    109567481 (SDC4)
Proteoglycans [BR:biu00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   109567481 (SDC4)
SSDB
Motif
Pfam: Syndecan Ycf70 PTP_tm
Other DBs
NCBI-GeneID: 109567481
NCBI-ProteinID: XP_019828017
Position
13
AA seq 199 aa
MAPARLLALLLLLVGVPAAAAESIRETEVIDPQDLLESRYFSGDLPDDEDVGGPGQESDD
FELSGSGDLDDSEDIRIFPEVMHPLVPIDNHIPEKTGSGVPTEPKELEENEVIPKRSSPF
DGDEDVSNKVSMSSTAQGSNIFERTEVLAALVVGGVVGILFAVFLVLLLVYRMKKKDEGS
YDLGKKPIYKKAPTNEFYA
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcccccgcccgcctgctcgcgctgctgctgctcctcgtgggcgtccccgccgccgcc
gccgagtcgatccgagaaactgaggtcatcgaccctcaagacctcctagaaagccgatac
ttttccggagacttaccagatgacgaggacgtcggggggcccgggcaggaatccgatgac
tttgagctgtctggctctggagatctagatgactcagaggacatccggatcttcccagaa
gtgatgcaccccttggtcccgatagataaccacatccctgagaagacagggagcggagtt
cccaccgaacccaaggaactggaagagaatgaagttatccccaagaggtcgtcccctttt
gatggggacgaagatgtgtccaacaaggtgtccatgtctagcacagcccagggcagcaac
atctttgagaggacagaggtgctggcagctctggtcgtgggcggtgtcgtgggcatcctg
ttcgccgtcttcctcgtgctgctgctggtgtaccgcatgaagaagaaggatgagggcagc
tacgacctgggcaagaaacccatctacaaaaaagcccccaccaatgagttctacgcctga

KEGG   Bos indicus (zebu cattle): 109568478
Entry
109568478         CDS       T04792                                 

Gene name
SDC2
Definition
(RefSeq) syndecan-2
  KO
K16336  syndecan 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu05144  Malaria
biu05205  Proteoglycans in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109568478 (SDC2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109568478 (SDC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109568478 (SDC2)
  09174 Infectious disease: parasitic
   05144 Malaria
    109568478 (SDC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109568478 (SDC2)
   00535 Proteoglycans [BR:biu00535]
    109568478 (SDC2)
CD molecules [BR:biu04090]
 Proteins
  109568478 (SDC2)
Proteoglycans [BR:biu00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   109568478 (SDC2)
SSDB
Motif
Pfam: Syndecan Glycophorin_A DUF2721 ATG22 Peptidase_M50 Cadherin_C_2 DUF2407_C MtrF
Other DBs
NCBI-GeneID: 109568478
NCBI-ProteinID: XP_019829357
Position
14
AA seq 173 aa
MYLDNSSIEEASGVYPIDDDDYASASGSGAGEDGESPELTTSRPIPKIPFTSTAPRVETT
TLSKIQDKIPAQTKSPEEIDKEKVHLPDSERKTDPAEEDTNVYTEKHSDNLFKRTEVLAA
VIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtaccttgacaacagctccattgaagaagcttcaggagtgtatcctattgacgatgac
gactacgcgtctgcatcaggctcgggagctggtgaggatggagagagtccagagctgacc
acgtctcgrcccattccaaagataccattcactagtactgctccaagagtggaaaccaca
acgctgagcaagatacaggacaagatccctgctcagacaaagtcacctgaagaaattgat
aaggaaaaagttcacctycctgactcagaaaggaaaacggacccagctgaagaggacaca
aacgtatatactgagaagcactcagacaatctgtttaaacgaacagaagtcctggcagct
gtcattgctggcggagttattggctttctctttgcaattttcctcatcctgctgttggtg
tatcgcatgagaaagaaggatgaaggaagttatgaccttggagaacgcaaaccatccagt
gctgcttatcagaaggcacctactaaggagttttatgcgtga

KEGG   Bos indicus (zebu cattle): 109572676
Entry
109572676         CDS       T04792                                 

Gene name
SDC3
Definition
(RefSeq) syndecan-3
  KO
K16337  syndecan 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109572676 (SDC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:biu00535]
    109572676 (SDC3)
Proteoglycans [BR:biu00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   109572676 (SDC3)
SSDB
Motif
Pfam: Syndecan
Other DBs
NCBI-GeneID: 109572676
NCBI-ProteinID: XP_019835229
Position
2
AA seq 346 aa
MRFSPDVALAMSTTPAVLPTMDIQPVGTPFEELPSERPTPEPATSPPLVTEVPEEPSQRA
TTVSTPTATTTATTTGPPTVATVPATVATAVPSIPAAPPSAATTSVVRTTGVRRLLPLPL
TTAATARATTPAVPSPPTTVAVLDTEAPTPRLVSTATSRPRALPRPATTQKPDIPEKSTL
PLGTTAPGPTEVAQTPTPESFLTTIRDEPEMPVSGGPSGDFELSEEETTQPDTANEVVAV
GGAEAKPSPPPGTLPKGAHPGPGLLDNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVG
ALFAAFLVTLLIYRMKKKDEGSYTLEEPKQASVTYQKPDKQEEFYA
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgcggttcagcccagatgtcgccctggcaatgtccaccacccccgcagtgctgcccacc
atggacatccagcctgtgggcaccccgtttgaagagctcccctctgagcgccccaccccg
gagccagccaccagccccccactggtgacagaggtgccagaagagcccagccagagagcc
accaccgtctccacccctacggctaccaccactgccaccaccacagggcccccgacggtg
gccacagtgcccgccacagtggccaccgccgtgcccagcatccctgcggcgcccccgtct
gcggccaccacctctgtcgtaaggaccaccggcgtacggaggcttctgcctctgccactg
accacagcggccacagcccgggccaccaccccagcggtgccctcacctcccaccacggtg
gctgtcttggacacagaggccccaacgcccaggctggtcagcacagctacctccaggcca
agggcccttcccaggccggctaccacccagaagcctgatatccctgagaagagcaccctg
cccctggggaccactgcccctggacccacggaggtggctcagaccccaactccagagtcc
ttcctgaccaccatccgggacgagccagagatgccagtgagcgggggacccagtggggac
tttgagctgtcagaggaagagaccacacagccagacacagccaatgaagtggtggctgtg
ggtggggccgaggccaagccatcacctccgccagggacgctgcccaagggtgcccaccca
ggccctggcctcctggacaatgccatcgactcaggcagctcggcggctcagctgccccag
aagagcatcctggagcggaaggaggtgctcgtagctgtgatcgtgggcggggttgtaggc
gccctctttgctgccttcctggtcaccctgctcatctaccgcatgaagaagaaggatgag
ggcagctacacgctggaggagcccaagcaggcgagcgtcacataccagaagcctgacaag
caagaggagttctacgcctag

DBGET integrated database retrieval system