KEGG   Bos indicus (zebu cattle): 109566418
Entry
109566418         CDS       T04792                                 

Gene name
DAB2IP
Definition
(RefSeq) disabled homolog 2-interacting protein isoform X1
  KO
K19901  disabled homolog 2-interacting protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
biu04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109566418 (DAB2IP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109566418 (DAB2IP)
SSDB
Motif
Pfam: DUF3498 RasGAP C2 Bacillus_HBL PH PH_2 Med4
Other DBs
NCBI-GeneID: 109566418
NCBI-ProteinID: XP_019826302
Position
11
AA seq 1205 aa
METASVHKSGGARGWGPIRHGARLPLGPRRLLRVAPRKAGLPAQPAWQPLGEEPQHGALG
HHAVPGHGNYPCVTIATWPGGCSATPRPPFLEPHGPGRASSLPCSRSHLMPRLKESRSHE
SLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAAERDKWME
NLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVF
WGEHFEFHNLPPLRMVTVHLYRETDKKKKKERSSYLGLVSLPAASVAGRQFVEKWYPVVT
PNPKGGKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEM
ASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQ
DALGEFIKALYESDENCEVDPSKCSAADLPEHQGNLKMCCELAFCKIINSYCVFPRELKE
VFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIA
KVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETVSNTAGFEGYIDLGR
ELSSLHSLLWEAVSQLEQSIVSKLGPLPRILRDVHTALSTPGSGQLAGTNDLASTPGSGS
SSVSAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEP
DLQMANGGKSLSMVDLQDARVLDGEAGSPAGPDALTXDGQAPATQLVAGWPARAAPVSLA
GLATVRRAGQTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHS
SLSSHSNSEELAAAXKLGSFSSSTAAAAPEDLGRRPGELARRQVSLTEKGGQPTVPRQNS
AGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLASASPDWAGPGARLRQQ
SSSSKGDSPELKPRAVHKQGPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLR
SKEELSQAEKDLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRR
QQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIASLDAANARLMS
ALTQLKERGTYNEATGATNFHMWIKXHRIESKICQKCKRKKINKNTIAFETNTPPVLVYD
RSRKH
NT seq 3618 nt   +upstreamnt  +downstreamnt
atggagacagcctcggttcataaatcaggtggggccaggggctgggggcccatacgccat
ggagcccgactccctcttggaccaagacgactccttcgagtcgccccaagaaaggccggg
ctcccggcgcagcctgcctggcagcctctcggagaagagccccagcatggagccctcggc
caccacgccgttccgggtcacggtaactatccctgcgtcaccatcgccacctggcccggg
ggctgctctgcgaccccgcggccccccttcctggagcctcacggacctgggagagcatcc
agcctcccttgctctaggtctcatctgatgcccaggctgaaagagtctcgctcccacgag
tccctgctcagccccagcagcgcggtggaggcgctggacctcagcatggaggaggaggtg
gtcatcaagcccgtgcacagcagcatcctgggccaggactattgcttcgaggtgacgacg
tcctcaggaagcaagtgcttctcctgccggtcagcagctgagcgggataagtggatggag
aacctgcggcgagccgtgcatcccaacaaggacaacagccggcgtgtggagcacattctg
aagctgtgggtgatcgaagccaaggaccttccggccaagaagaagtacctgtgcgagctg
tgtctggacgacgtgttgtacgcgcgcaccacgggcaagctcaagaccgacaacgtcttc
tggggcgagcacttcgagttccacaacctgccgcccctgcgcatggtcaccgtccacctg
tatcgtgagactgacaagaagaagaagaaggagcgcagcagctacctgggcctggtgagc
ctgcccgccgcctctgtggccggccggcagttcgtggagaagtggtacccggtggtgact
cccaaccccaagggcggcaagggccccgggcccatgatccgcatcaaggcgcgctaccag
accatcaccatcctgcccatggagatgtacaaggagttcgccgagcacatcaccaaccac
tacctggggctctgcgctgccctcgagcccatcctcagcgccaagaccaaggaggagatg
gcgtcggccttggtgcacatcctgcagagcacgggcaaggtgaaggacttcctgaccgac
ctgatgatgtcggaggtggaccgctgtggggacaacgagcacctcatcttccgggagaac
acgctggccaccaaggctatcgaggagtacctcaagctggtgggccagaagtacctgcag
gacgcactaggggagttcatcaaagcgctgtacgagtcagacgagaactgtgaagtggac
ccaagcaagtgctcggccgctgacctccccgagcaccagggcaacctcaagatgtgctgc
gagctggccttctgcaaaatcatcaactcctactgcgtcttcccccgggagctcaaggag
gtgtttgcctcttggcggcaagagtgcagcagccgcggccggccggacatcagcgagcgg
ctcatcagcgcctccctgttcctgcgcttcctctgcccagccattatgtccccctcgctc
ttcaacctgcttcaggagtaccccgacgaccgcaccgctcgcacactcaccctcatcgcc
aaagtcacccagaacctggccaactttgccaagttcggcagcaaggaagagtacatgtcg
ttcatgaaccagttcctggagcacgagtggaccaacatgcagcgcttcctgctggagatc
tccaatcccgagaccgtctccaacacggctggcttcgagggctacatcgacctgggccgc
gagctctccagcctgcactcgctgctctgggargccgtcagccagctggagcagagcatc
gtatccaagctggggcctctgcctcgaatcctgagggacgtccacacagctctgagcacc
ccgggcagtgggcagctcgcaggcaccaacgacttggcctctacacctggctctggcagc
agcagcgtctcggctgggctgcagaagatggtaatcgagaacgacctstctggtctgata
gatttcacccggttaccgtctccaacccccgaaaacaaggacttgttttttgtcacaagg
tcctccggggtccagccctcacctgcccgcagctcgagttactcggaagccaacgagccc
gaccttcagatggccaacggcggcaagagtctgtccatggtggacctccaagacgcccgc
gtgctggatggggaggcgggctccccagcaggccccgacgccctcaccrccgatggccaa
gcgcctgccactcagctggtggccgggtggccggcccgggcggcccccgtgagcctggcg
gggctggccacagtgcggcgggcaggccagacgcccaccacgccgggcacgtcggagggc
gcgccaggccggccccagctcctggcaccgctgtccttccagaatcccgtgtaccagatg
gcggctggcctgccgctgtctccccgcggcctcggcgactcgggctctgagggccacagc
tccctgagctcccacagcaacagtgaagagctggcagctgccrccaagctgggcagcttc
agcagcagcactgccgccgccgcccccgaagacctgggccggcgccctggggagctggca
cggcggcaggtgtcgctgaccgagaagggtgggcagcctacagtgccacggcagaacagc
gcyggcccccagcggaggatcgaccagccgccgccgccacccccgccgccgccccctgca
ccccgcggccggacgccacccaccctgctgagcaccctgcagtacccacggccgtcgagy
gggacgctggcctcagcctcgcccgactgggctgggcccggagcccggctgcggcaacag
tcytcatcctccaagggygacagccccgagctgaagcctcgcgccgtgcacaagcagggc
ccttcacccgtgagccccaatgccctggaccgcacggctgcctggctcttgaccatgaat
gcgcagttgttagaagacgagggcctgggcccagaccccccgcacagggataggctaagg
agtaaggaggaactcagccaagcggaaaaggacctggcagtgctgcaggacaagttgcga
atctccaccaagaagctggaggagtatgagaccctgttcaagtgccaggaggagacaacc
cagaagctagtgctggagtaccaggcacggctagaggagggcgaggagcggctgcgacgg
cagcaagaggacaaggacatccagatgaagggcatcatcagcaggttgatgtcagtggag
gaggagctgaagaaggaccacgcggagatgcaggcagctgtagactccaaacagaagatc
attgacgctcaggagaagcgcatcgcttcactggacgcggccaacgcgcgcctcatgagc
gccctgacgcagctcaaagagagaggcacttacaatgaagctacaggagccacgaacttc
cacatgtggattaagkagcatcggatagaaagcaaaatctgccagaaatgcaagaggaaa
aaaatcaacaaaaacacaattgcatttgagactaacacaccaccagtattagtttatgac
agatcaaggaaacattaa

DBGET integrated database retrieval system