KEGG   Bos indicus (zebu cattle): 109566462
Entry
109566462         CDS       T04792                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04514  Cell adhesion molecules
biu04640  Hematopoietic cell lineage
biu04810  Regulation of actin cytoskeleton
biu05145  Toxoplasmosis
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05222  Small cell lung cancer
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109566462 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109566462 (ITGA6)
   04514 Cell adhesion molecules
    109566462 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109566462 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109566462 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109566462 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109566462 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109566462 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109566462 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109566462 (ITGA6)
   05414 Dilated cardiomyopathy
    109566462 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109566462 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109566462 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109566462 (ITGA6)
   04515 Cell adhesion molecules [BR:biu04515]
    109566462 (ITGA6)
   04090 CD molecules [BR:biu04090]
    109566462 (ITGA6)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109566462 (ITGA6)
  Exosomal proteins of breast milk
   109566462 (ITGA6)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin alpha subunits
   109566462 (ITGA6)
CD molecules [BR:biu04090]
 Proteins
  109566462 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM Integrin_alpha
Other DBs
NCBI-GeneID: 109566462
NCBI-ProteinID: XP_019826390
Position
2
AA seq 1091 aa
MAAAGRLWLLYLSVGLLPRLGTAFNLDTREDNVIEKTGDSGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAVALPLQKANRTGGLYSCDITSRGPCTRIEFDNDADPSSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQXGVAATFTKDFHYIAFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDLKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRSGEVGGAAYVYINQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDGKGKVFIYHGSANGINTK
PTQVLEGKSPFFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQQTITVTPNR
IDLRQKTLCGAPSGICLKVKACFEYTAKPTGYNPSITIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYSQELTLNRQKQKACMEETLWLQENIRDKLRPIPITASVEIQEPSTRRRVNSL
PEVLPILNSNEPKFVHTDVHFLKEGCGDDNICNSNLKLEYKFCTREGNQDKFSYLPIHKG
VPELVLKDQKDIALEITVTNSPSNPKNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLETTSNQD
NLASITATAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEEDVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKITCEPQGEINFLKLTEAHNSRR
KREIAERQTDDGRKFSLFSEXKYQTLNCSVNVNCVNIKCPLRGLDSKASVVLRSRLWNST
FLEEYSKMNYLDILVRASIDVIAATENIKLPNAGTQVRVTVFPSKTVAQHSGVPWWIILV
AILAGILMLGLLVFLLWKCGFFKRSRYDDSVPRYHAVRIRKEEREIPDEKYNDNPEKKQW
ITKWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggcggccgcggggcggctgtggctgctttacctgtcagtggggctcctgccgcggctc
ggcaccgccttcaacttggacacccgcgaggacaatgtgatcgagaaaactggggactcc
gggagccttttcggcttctcgctggcgatgcactggcagctgcagcctgaggacaagcgg
ctattgctcgtgggggctccccgtgcagtggcccttccactgcagaaggccaacagaaca
ggaggcttgtacagctgcgacatcacctcccgggggccgtgcacgcgaattgaatttgat
aacgacgctgacccttcatcggaaagcaaggaagatcagtggatgggagtcactgtccaa
agccagggtccaggcggcaaagttgtgacatgtgctcatcgatatgaaaaaagacaacat
gttaatacgaagcaggaatcccgagacatctttggaaggtgctacgtcctaagtcagaat
ctcaggattgaagatgatatggatggaggagactggagtttttgtgatggccggttgaga
ggtcatgaaaaatttggttcttgccagcmaggtgtagcagctacttttactaaagacttc
cattacattgcgtttggagccccaggcacttacaactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagactgaccatgatgaaagtctagttcctgttcctgctaacagttatttaggcttt
tctttggactcggggaaaggtattgtttccaaagatgagatcactttcgtgtctggtgct
cctagagccaatcatagtggagcggtggttttgcttaaaagagacctgaagtctgcgcac
cttctccctgagcacatatttgatggggaagggctggcttcttcatttggctatgacgta
gcagtggtggacctcaacaaagacgggtggcaagatatagttattggagccccacagtat
tttgatagaagtggagaagttggaggtgcagcgtatgtctacattaaccagcaaggcaga
tggaataacgtcaagccgattcgtcttaatggaaccaaagattctatgtttggcattgca
gtcaaaaatattggtgatattaatcaagatggctacccagatattgcggttggagcaccc
tatgatggtaaggggaaggtttttatctatcatggatctgcgaatggaataaataccaaa
ccaacacaggttcttgagggtaagtcacccttttttggatattcaattgctggaaacatg
gaccttgatagaaattcctaccctgatgttgctgttggttctctctcagattcggtgact
attttcagatcccggcctgtgattaatattcagcaaaccatcacagtaacacccaacaga
attgatctccgtcagaaaacgctctgtggggcgcctagtgggatatgcctcaaggttaag
gcctgttttgaatatactgctaaacccaccggttacaatccttcaataaccattgtgggc
actctggaggctgaaaaggaaagaagaaaatctgggctgtcgtcaagagttcagtttcga
aaccaaggttctgagcccaagtattcgcaagagctcactctgaacagacagaaacagaag
gcgtgcatggargaaaccctctggctccaggaaaacatcagagataaactgcgtcccatt
cccataactgcttcagtggagatccaggagccaagcactcggaggcgagtgaattcgctt
ccagaagttctcccaattctaaattcaaatgaacccaagtttgttcatacagatgtgcac
ttcttaaaagagggatgtggagacgacaacatatgtaacagcaaccttaagctagagtat
aaattttgtacccgagaaggaaatcaggacaagttttcttatttaccaattcacaaaggt
gtaccagaactagttctaaaagatcagaaggacattgctttagaaataacagtgacgaac
agcccttctaacccaaagaatcccaccaaagatggtgacgacgctcacgaagctaaactc
attgccacttttccagacactctgacttactctgcatatagagaactgagggctttccct
gagaagcagttgagttgtgttgccaaccagaatggctcacaagcagactgtgagcttggg
aatccttttaaaagaaattccagtgttactttttatttgattttaagtacaactgaggtc
acctttgacaccacagatctggatattaatctgaagttggaaacaacaagcaatcaagat
aatttggcttcaattacagctacagcaaaagtggttattgaactgcttttatcggtctcc
ggggttgctaaaccttcccaggtgtattttggaggtacagtagttggtgagcaagcgatg
aaatctgaagaggacgtgggaagtttaattgagtacgagttcagggtaattaacttgggc
aaacctcttaaaaacctcggcacagcaaccttgaatatccagtggccaaaagaaattagc
aacggcaaatggttgctttatttggtgaaagtagaatcaaaaggattggaaaaaataact
tgtgagccacagggtgaaataaacttcctgaaactaacggaggctcacaactcaagaagg
aaacgagaaattgctgaaagacagacagatgatggcagaaaattttctttattttctgaa
rgaaaatatcagacccttaactgcagcgtgaacgtgaactgtgtgaacatcaagtgcccg
ctgcgagggctggacagcaaggcctccgtggtcctgcgctcgaggttatggaacagcacg
tttctagaggaatactccaagatgaactacttggacattctcgtgcgggcttccattgat
gtcattgccgccaccgagaatatcaagctgcccaacgcaggcactcaggttcgcgtgact
gtgtttccctcaaagactgtagctcaacattcaggagtaccttggtggatcatcctagtg
gccattcttgctgggattttgatgcttggtctattagtatttttactgtggaagtgtgga
ttctttaaacgctctaggtacgatgatagcgttccccgataccacgctgtaaggatccgg
aaagaagagcgagagatcccagatgaaaaatataatgataaccctgaaaaaaaacagtgg
atcacaaagtggaatgaaaatgaaagctactcctag

DBGET integrated database retrieval system